keyword - BobObst
45 122 1002 1036 1051 1058 1069 1353 1743 1744 1745 1746 1747 1748 1749 1750 1751 1752 1753 1754 1755 1756 1757 1758 1760 1761 1762 1763 1764 1765 1766 1768 1769 1770 1983 1984 1987 2007 2012 2013 2014 2183 2184 2185 2186 2187 2436 2703 2781 2782 2785 2942 3116 3138 3191 3303 3541 3641 3642 4066 4102 4117 4118 4120 4122 4127 4131 4146 4183 4240 4263 4344 4430 4431 4443 4444 4466 4494 4510 4546 4558 4581 4585 4586 4587 4589 4591 4642 4648 4685 4882 4966 4967 4978 4997 5019 5022 5040 5079 5082 5096 5138 5145 5157 5212 5229 5232 5261 5302 5336 5350 5365 5366 5367 5384 5399 5406 5408 5530 5642 5657 5682 5969 6039 6061 6068 6069 6070 6072 6073 6074 6075 6076 6077 6078 6079 6081 6082 6083 6084 6085 6086 6108 6109 6474 6475 6502 6695 6716 6835 6951 6952 7048 7122 7257 7398 7479 7481 7531 7538 7543 7545 7548 7553 7564 7566 7567 7570 7573 7590 7608 7610 7611 7612 7614 7616 7617 7618 7630 7631 7632 7634 7635 7638 7642 7648 7650 7673 7674 7688 7694 7697 7698 7700 7703 7704 7709 7711 7717 7719 7726 7728 7732 7733 7738 7740 7741 7743 7744 7748 7752 7754 7755 7756 7761 7763 7764 7765 7766 7767 7768 7775 7783 7785 7787 7788 7789 7795 7796 7797 7798 7799 7800 7801 7804 7809 7811 7814 7819 7821 7823 7826 7827 7828 7830 7831 7837 7848 7851 7856 7857 7864 7879 7883 7974 8191 8268 8279 8280 8281 8283 8285 8286 8287 8288 8289 8290 8293 8294 8295 8305 8311 8314 8339 8416 8424 8565 8628 8720 8732 8735 8757 8759 8770 8771 8772 8773 8774 8781 8782 8790 8792 8805 8807 8809 8810 8811 8816 8819 8820 8832 8847 8859 8860 8861 8864 8897 8902 8911 8912 8913 9277 9457 9558 9559 9560 9622 9655 9669 9670 9671 9673 9700 9900 9948 48231 60761 ' ' iceland water pure extraordinaire ' arthur robert obst filling his water container with icy refreshment in a cascading tributary of the tungnaa river that flows through a canyon guarded by mountains of volcanic obsidian and rhyolite which is situated between the landmannalaugar area camp and mount blahnukur within south western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 5 august 2015 ' please buy it here ' please buy it here httpwww.robertarthurobstphotos.comlandscapesinspirational ' temperance river gorge's sunsparkled whitewater 'trek iceland' hikers ascending scree 'trek iceland' hikers on the trail between the landmannalaugar area camp and 3100 ft mount blahnukur within south western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 5 august 2015 'trek iceland' hikers pausing hiking up over scree 00 cdt 744 cfs or 8.58 ft 00 cdt flow cfs 1 0001 0002 0003 0004 0006 0007 0008 0017 0019 0048 0078 0079 0100 0118 0155 0181 02.29 0200 0202 0204 0216 0217 0219 0223 0229 024 m within great smoky mountains national park usa nc tn gatlinburg 0240 0247 0295 0310 0391 0393 03cropped 03croppedv 0431 0445 0462 0562 0589 06.01 0610 0638 0652 0679 0696 0867 0920 0940 0983 0987 09_0a08_gc 09_0a12_gc 09_0a13_gc 09_0a18_gc 09_0a20_grandcanyon 09_0a21_grandcany 09_0a28_grandcany 09_0a30_gc 09_0a31_gc 09_0a33_gc 09_0a35_gc 09_0b03_grandcany 09_0b04_gc 09_0b08_gc 09_0b14_gc 09_0b16_gc 09_0b20_gc 09_0b21_gc 0b09 0b13 0b29 0c24 0d03 0d11 1 august 2015 arthur robert obst with the amazing all glass and steel 'harpa concert hall and conference center' situated along the colorful and historic ocean front of downtown reykjavik iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland reykjavik 1 august 2015 hiker's view of the amazing reflective all glass and steel 'harpa concert hall and conference center' situated along the colorful and historic ocean front of downtown reykjavik iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland reykjavik 1 august 2015 leifr eiricsson's statue in front of the 240 foot high hallgrimskirkja church within downtown reykjavik iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland reykjavik 1 august 2015 visitor's view of the 240 foot high hallgrimskirkja church within downtown reykjavik iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland reykjavik 1 august 2015 walkerexplorers view of the amazing all glass and steel 'harpa concert hall and conference center' situated along the colorful and historic ocean front of downtown reykjavik iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland reykjavik 11.08.2011 11.10 12 century fort ruins at la roque gageac france 12.15 12.15.2011 130 cfs 16 august 2007 17 august 2007 17july2016draft 1july2016draft 2 august 2015 arthur robert obst and elysia noelle obst all all smiles with their horses during our eldhestar volcanic horses hot springs ride within south western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland reykjavik 2 august 2015 arthur robert obst exploring the lava cracks and caves near lake pingvallavatn within pingvellir national park of western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland reykjavik pingvellir 2 august 2015 checking into hotel edda east of pingvellir national park in largarvatn within western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland largarvatn 2 august 2015 dramatic scenery surrounds lake pingvallavatn near pingvellir national park within western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland reykjavik pingvellir 2 august 2015 horseback rider's view of a colorful geothermal area during our eldhestar volcanic horses hot springs ride within south western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland hveragerði 2 august 2015 horseback rider's view of typical moss and flower and dwarf tree covered icelandic volcanic landscape during the eldhestar volcanic horses hot springs ride within south western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland reykjavik 2 august 2015 left to right elysia noelle obst and arthur robert obst with their horses after our eldhestar volcanic horses hot springs ride within south western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland hveragerði 2 august 2015 left to right elysia noelle obst and robert arthur obst and arthur robert obst enjoying a break during our eldhestar volcanic horses hot springs ride within south western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland hveragerði 20 day boulder canoe pinball wizard frisk 2012 autumnal equinox harvest moon rising over lake mendota and the state capitol of madison wisconsin and pheasant branch conservany within middleton wi usa 2012 nikon d300s image 3292 2012 nikon d300s image 3339 2012 nikon d300s image 3415c 2012 nikon d300s image 3471 2012 picture of the tallest building in madison or the wisconsin state capitol 2012icfjunioru23canoeslalomworlds 2013 nikon 800 image 7449 2013 nikon 800 image 7454 2013 obst fav nature enchanting flowers forests foliage image 7793 2014 23 june 2014 through 13 july 2014 usa id mt obst family ad 2014 23 june 2014 through 13 july 2014 usa id mt obst family adv 2014 23 june 2014 through 13 july 2014 usa id mt obst family adventure travel images of hiking and whitewater paddling within idaho usa and hiking within montana usa and the national parks of the canadian rockies within alberta and british columbia canada by robert arthur obst usa id mt can alberta british columbia 2014 green river race official competition classes were all boats and long boats and short boats and women and hand paddles and c1 and oc1 2014 images by imagery creation evangelist bob obst of his fav o 2014 images by imagery creation evangelist bob obst of his fav or favorite obst family outings within sixty miles or 60 mi or about an hour drive from the madison middleton area of southern wisconsin 2014 images by imagery creation evangelist bob obst of the final results and semifinal results for the world championships event in canoe kayak slalom whitewater at the adventure sports center international site near deep creek lake and mchenry maryland and within garrett county md usa 2014 images by imagery creation evangelist bob obst of the final results for the world championships event in canoe kayak slalom whitewater at the adventure sports center international site near deep creek lake and mchenry maryland and within garrett county md usa 2014 images by imagery creation evangelist bob obst of the semifinal results for the world championships event in canoe kayak slalom whitewater at the adventure sports center international site near deep creek lake and mchenry maryland and within garrett county md usa 2014 vs 2010 image collage of the athabasca glacier and the columbia icefield area within jasper national park near jasper alberta canada obst family adventure travel program within the usa west mt and canada alberta british columbia within the canadian rockies near the icefields parkway images by imagery creation evangelist robert arthur obst usa id mt can alberta bc 2014 wolfman triathlon 20th anniversary event 1994 to 2014 2014 world championships event at deep creek lake and near mchenry maryland 2014 world championships event in canoe kayak slalom whitewater near deep creek lake and mchenry maryland at the adventure sports center international site within garrett county md usa 2014nov1greenrivernarrowsraceresults 2014wc.c1.f 2014wc.c1.fl 2016 alaskan whales and wildlife magic or awawm video project 2016 alaskan whales and wildlife magic video project 2016 alaskan whales and wildlife magic video project or awawm vp 213 ft and the mt. brown lookout at 7 243624102220224122332737225922912306222324292426.nef 26 may 2014 image 3 august 2015 arthur robert obst's view from near the visitor center near lake pingvallavatn of the volcanic rift valley within pingvellir national park and western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland pingvellir 3 august 2015 arthur robert obst's view from near the visitor center of the boulders along the volcanic rift canyon within pingvellir national park and western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland pingvellir 3 august 2015 caver's preparing to enter a lava tube cave during their arctic adventures 'black and blue lava cave adventure' within pingvellir national park and western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland pingvellir 3 august 2015 caver's underground conference during our arctic adventures 'black and blue lava cave adventure' within pingvellir national park and western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland pingvellir 3 august 2015 caver's view of our arctic adventures black and blue group preparing to enter the dark entrance of a lava tube cave within pingvellir national park and western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland pingvellir 3 august 2015 cavers carefully making their way over the steep and boulder strewn floor of a lava tube cave during their arctic adventures 'black and blue lava cave adventure' within pingvellir national park and western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland pingvellir 3 august 2015 from stormy to clear blue skies iceland weather may change in a flash over places like hotel edda in laugarvatn within western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland laugarvatn 3 august 2015 hiker's view from near the visitor center of the volcanic rift canyon wall within pingvellir national park and western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland pingvellir 3 august 2015 hiker's view from near the visitor center of the volcanic rift valley within pingvellir national park and western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland pingvellir 3 august 2015 hiker's view of boulders along the volcanic rift canyon wall within pingvellir national park and western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland pingvellir 3 august 2015 iceland weather may change in a flash over hotel edda in laugarvatn within western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland laugarvatn 3 august 2015 snorkelers elysia and arthur obst preparing for their arctic adventures 'black and blue lava cave snorkeling adventure' within pingvellir national park and western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland pingvellir 3 august 2015 stormy weather over the flowered verdant shores and waters of lake pingvallavatn within pingvellir national park and western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland pingvellir 3 august 2015 stormy weather over the gorgeous verdure volcanic rift valley by lake pingvallavatn within pingvellir national park and western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland pingvellir 3 august 2015 youth hiker's view of oxara river flowing through a volcanic rift valley towards lake pingvallavatn within pingvellir national park and western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland pingvellir 31 august 2014 at 2 pm usgs 0407490 wolf river at langlade wi gauge flow rate of 573 cfs or 573 cubic feet per second or 8.38 feet 31 august 2014 at 2 pm usgs 04074950 wolf river at langlade wi gauge flow rate of 573 cfs or 573 cubic feet per second or 8.38 feet 31 july 2015 italia restaurant with arthur and elysia obst within reykjavik iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland reykjavik 410 and gauge height feet 9.40 or approx. 25 inches on old gauge 478 ft hiking with arthur robert obst on 2 july 2014 within glacier national park on the mt. brown lookout trail 2014 23 june 2014 through 13 july 2014 usa id mt obst family adventure travel program of hiking and whitewater paddling within idaho usa and hiking within montana usa and the national parks of the canadian rockies within alberta and british columbia can by imagery creation evangelist robert arthur obst usa id mt can alberta bc 5 august 2012 in madison wisconsin usa with a mean temperature 70 f and max temperature 78 f and min temperature 61 f and average humidity 64 was a perfect summer day 5014.02 5019.02 5022.01 5027.02 5028.02 5572.02 5753.02 5757.02 5759.02 5882.02 5883.02 6 september 2014 at 10 am usgs 04074950 wolf river at langlade wi gauge flow rate of 912 cubic feet per second or or 912 cfs or 8.91 ft 6031c 6086586116 6321.02 6321.03 6324.02 6327.02 6328.02 6329.02 643 ft of smoky mountains marching to the horizon within great smoky mountains national park usa nc tn gatlinburg 643 ft or 2 6474.02 6474.03 6475.02 6475.03 7787 li 7796b 7799.m 7864 dws 7879 dws 81.898792 825 or 861 meters 8774m 8912a 8912b 9560b 9670a 9670b a a flowery run by oc2 mixed 15 racer bib no 127 elizabeth andre and clayton cole of ashland wi usa action at the 2016 aca open canoe usa slalom nationals north american championships 22 24 july 2016 usa wi wausau a friendly mule deer grazing outside my tent in my signal mountain campsite on jackson lake within grand teton national park a frozen waterfall and icicles embellish sandstone cliff within apostle islands national lakeshore on lake superior a gorgeous summer day under cerulean skies at the university of wi madison memorial union terrace on lake mendota usa wi madison a grand view frames american family insurance agent robert john obst near nankoweap granaries at mile 53 of the colorado river within grand canyon national park usa az grand canyon a heron enjoys its sunny perch in view of walkers along the burrard inlet and pacific ocean within the port of vancouver can bc vancouver a hugh waterfall fills the maligne river gorge with thunder and whitewater within jasper national park a humid and evil sky over the wolf river refuge with black angry clouds swirling as a tornado passes between lily and hollister north of this location within the wolf river territory a julia butterfly or dryas iulia also known as julia heliconian or the flame or or flambeau within olbrich botanical gardens during 18 july to 12 august 2012 blooming butterflies usa wi madison a local 'cowboy' and his family by their camp fire within the valley of the greys rivers near alpine wyoming major retirement adventure travel by robert arhtur obst tofrom usa wy 13 to 27 of may 2015 spring into yellowstone events including selfguided tours of yellowstone national park and grand teton national park areas and return to usa wi middleton usa wy alpine a lone bald eagle guards steep slopes lined with pink quartzite cliffs a lonely alaskan fishing boat crusing through evening light over blue seas between glacier bay and college fjord in the gulf of alaska usa alaska gustavus a paddler is allsmiles after she plunges her inflatable kayak over sullivan falls on section 4 of the wild wolf river between otter slide and big smoky falls within the menominee indian nation of wisconsin usa wi keshena a perfect day for sailing on lake mendota near observatory drive and the university of wisconsin madison campus usa wi madison a perfect day for wind surfing on lake mendota near the memorial union terrace of the university of wisconsin madison campus usa wi madison a perspective rarely captured of lower yellowstone falls within yellowstone national prk a rainbow forms over athabasca falls within jasper national park a rare 'full blood supermoon lunar eclipse' that occurred between about 911 pm and 1023 pm on the 27 of september 2015 over the pheasant branch creek conservany and the lake mendota waterfront near captain bills restaurant within middleton wi usa fav or favorite obst family outings within southern wisconsin usa usa wi madison middleton a red sunset over grandparents residence near the wolf river refuge within the wolf river territory a serious bow draw for competition canoe cruising team concentration and chaos for a tandem competition cruiser open canoe team in lower sherry rapids during the 2014 wolfman triathlon at 912 cubic feet per second or 8.91 ft on the langlade usgs gauge on section 2 of the wild wolf river a shy red fox or vulpes vulpes entertains kantishna experience bus riders on denali park road within denali national park usa alaska denali park a shy red fox or vulpes vulpes on the denali park road within denali national park of alaska a shy red fox or vulpes vulpes on the denali park road within denali national park usa alaska denali park a sleepy common snapping turtle guarding or laying its eggs near the wolf river refuge within the wolf river territory a strategic view highlights golden opportunities to the horizon a strategic view is ideal a strategic view is usually best a talented youth swooshes a basketball on sports deck nine of the holland america zaandam cruise ship usa alaska inside passage near ketchikan a tranquil stream between summitt lake and bernard lake near the white pass railway and klondike highway and fraser british columbia canada usa alaska skagway a wild and free butterfly with blue spots along its wings within the outside olbrich botanical gardens usa wi madison a winter wonderland during the summer a winter wonderland of ice and deep snow over the cascade river gorge and its frozen waterfalls within cascade river state park on the north shore of lake superior a winter wonderland of ice and deep snow over the cascade river gorge within cascade river state park on the north shore of lake superior a youth hiker enjoys a peaceful moment along the rugged shorelines bordering smugglers cove and skagway harbor of taiya inlet and the upper lynn canal usa alaska skagway a youth hiker enjoys a peaceful perch among granite shorelines along smugglers cove and skagway harbor of taiya inlet and the upper lynn canal of the pacific ocean a youth hiker enjoys tranquil views from a perch among granite shorelines along smugglers cove and skagway harbor of taiya inlet and the upper lynn canal of the pacific ocean a zebra butterfly or heliconius charitonia within olbrich botanical gardens during 18 july to 12 august 2012 blooming butterflies usa wi madison aaba aare rhein lutschine rivers watershed aaron island according to posted icf race results as of 26 july 2012 the first name of this paddler is spelled juri ace usa whitewater tandem decked canoe team of dave hearn kent ford jon lugbill at the 1985 augsberg world whitewater championships acer saccharum or sugar maple native to hardwood forests of northeastern north america including nova scotia southern ontario georgia texas acrobatic and frustrated young vermin chasing winter the cat hunting for moths or heterocera at night in the wolf river refuge usa wi langlade action at the 2016 aca open canoe usa slalom nationals north action at the 2016 aca open canoe usa slalom nationals north american championships 22 24 july 2016 action at the 2016 aca open canoe usa slalom nationals north american championships 22 24 july 2016 usa wi wausau action sports fun hogs extraordinaire admiralty island adventure photos alaska adventure travel adventure travel all time favorites adventure travel all time favorites of bob obst adventure travel canada banff national park adventure travel canada banff national park bow river valley adventure travel canada banff national park moraine lake adventure travel canada jasper national park athabasca river valley whistlers mountain jasper tramway adventure travel canada jasper national park maligne lake adventure travel canada jasper national park maligne river canyon adventure travel canada jasper national park maligne river valley adventure travel canada jasper national park maligne river valley mountain goats adventure travel canada jasper national park the icefields parkway adventure travel canada jasper national park the icefields parkway honeymoon lake adventure travel canada jasper national park the icefields parkway mount athabasca adventure travel canada jasper national park the icefields parkway mount fryatt adventure travel canada jasper national park the icefields parkway mt. edith cavell path of the glacier loop adventure travel canada jasper national park the icefields parkway sunwapta and athabasca river valleys adventure travel canada jasper national park the icefields parkway sunwapta falls adventure travel canada jasper national park the icefields parkway sunwapta river gorge adventure travel canada kootenay national park adventure travel grand teton national park snake river valley adventure travel lake superior circle tour adventure travel lake superior circle tour porcupine mountains wilderness state park adventure travel lake superior circle tour usa mi ontonagon porcupine mountains wilderness state park rustic campsite near presque isle river mouth sunset over lake superior adventure travel lake superior circle tours adventure travel lake superior circle tours during winter adventure travel lake superior circle tours pmwsp adventure travel lake superior circle tours porcupine mountains wilderness state park adventure travel lake superior circle tours porcupine mountains wilderness state park pmws adventure travel lake superior circle tours usa mi copper harbor adventure travel lake superior circle tours usa mi ontonagon pmwsp adventure travel lake superior circle tours usa mn silver bay adventure travel lake superior circle tours usa wi bayfield apostle islands adventure travel obst 2011 adventure travel obst canada adventure travel obst canada banff national park mistaya river canyon adventure travel obst canada banff national park mistaya river valley adventure travel obst canada vancouver adventure travel obst family western usa alaska adventure travel obst retirement program adventure travel obst usa mi lake superior circle tours black river recreation area adventure travel obst usa mi lake superior circle tours porcupine mountains wilderness state park adventure travel obst usa west and canada 2014 adventure travel robert obst retirement program images adventure travel south padre island paragliding adventure travel usa west adventure travel usa west canada banff national park adventure travel usa west canada kootenay national park adventure travel usa west canada yoho national park adventure travel usa west canada yoho national park emerald lake adventure travel usa west montana glacier national park adventure travel usa wi ice age national scenic trail adventure travel west rocky mountain national park adventure travel western usa adventure travel western usa canada adventure travel yellowstone national park adventure travels obst family 2011 adventure travels usa texas adventure travels usa western adventureo adventureo and obst at retirement program sharegroups adventureo at httpwww.robertarthurobstphotos.comsharegtdmwvdy76lvc adventures in paddlesport canoeing kayaking inflatable adventures in paddlesport competition adventures in paddlesport competition 2014 'deep creek' world championships for canoe kayak slalom whitewater adventures in paddlesport competition 2014 'deep creek' world championships for canoe kayak slalom whitewater usa md mchenry adventures in paddlesport competition whitewater 2014 world championships deep creek event in canoe kayak slalom whitewater near mchenry maryland usa adventures in paddlesport expedition adventures in paddlesport quietwater moving water adventures in paddlesport waterways wolf river adventures in paddlesport whitewater adventures in paddlesport whitewater competition 2014 wolfman triathlon 20th anniversary event 1994 to 2014 adventures in paddlesports waterways wolf river adventures in paddlesports whitewate adventures paddle sport waterways adventures paddlesport adventures paddlesport competition slalom adventures paddlesport competition whitewater adventures paddlesport competition whitewater slalom adventures paddlesport europe adventures paddlesport kayaking adventures paddlesport or ap quietwater moving water adventures paddlesport quietwater adventures paddlesport quietwater moving water adventures paddlesport quietwater whitewater adventures paddlesport quietwater whitewater europe adventures paddlesport quietwater whitewater wisconsin adventures paddlesport waterways adventures paddlesport waterways class four to five or class 4 to 5 linville river gorge adventures paddlesport waterways usa maine adventures paddlesport waterways wolf river adventures paddlesport waterways wolf river section four adventures paddlesport whitewater adventures paddlesport whitewater quietwater wisconsin adventures paddlesport whitewater waterways idaho adventures paddlesport whitewater waterways idaho oregon adventures paddlesport whitewater waterways usa idaho adventures paddlesport wisconsin adventures paddlesports adventures paddlesports quietwater adventures phase 12 homer alaska to girdwood alaska adventures phase 13 homer alaska to girdwood alaska adventures travel adventures travel action adventures travel action extraordinaire adventures travel action extraordinaire daily favorite travel adventures travel bob obst daily favorites adventures travel canada adventures travel cross country skiing adventures travel cross country skiing snowshoeing adventures travel daily favorite adventures travel destinations wild national parks western usa wyoming yellowstone national park grand loop road near yellowstone river adventures travel extraordinaire adventures travel kettle moraine ice age national scenic trail adventures travel lake superior circle tours adventures travel lake superior circle tours canada ontario north shore of lake superior adventures travel obst 2010 canada alberta banff national park adventures travel obst 2010 canada alberta banff national park bow river valley adventures travel obst 2010 canada alberta banff national park mistaya river canyon adventures travel obst 2010 canada alberta banff national park mistaya river valley adventures travel obst 2010 canada alberta banff national park moraine lake adventures travel obst 2010 canada alberta jasper national park adventures travel obst best adventures travel obst canada 2010 adventures travel sailing july 1993 adventures travel usa adventures travel usa western adventures travel usa wisconsin bad river copper falls state park bad river gorge mellen adventures travel west adventures travel western usa adventures travel western usa bryce canyon national park adventures travel western usa montana mt adventures travel western usa montana mt glacier national park gnp adventures travel western usa wyoming adventures travel western usa wyoming yellowstone national park adventures travel western usa wyoming yellowstone national park ynp grand loop road adventures travel western usa yellowstone national park grand loop road upper geyser basin castle geyser adventures travel wisconsin best adventurespaddlesport competition whitewater imagesvideo by robert a. obst adventurestravel lake superior circle tours canada ontario heron bay pukaskwa national park adventurestravel wisconsin best adventuretravelwithkidso adventuretravelwithkidso at httpwww.robertarthurobstphotos.comsharevdz9xqno4lxic aerial view of dark mountains embracing glacier fed tributaries which flow south from near kennicott glacier northwest of kennicott within wrangell st. elias national park and preserve usa alaska mccarthy aerial view of glacier flowing off regal mountain within wrangell st. elias national park and preserve aerial view of kennicott glacier flowing off mount blackburn within wrangell st. elias national park and preserve aerial view of kennicott glacier flowing off regal mountain within wrangell st. elias national park and preserve aerial view of streams flowing from kennicott glacier within wrangell st. elias national park and preserve aerial view of the top of kennicott glacier within wrangell st. elias national park and preserve agastache scrophularlaefolia or giant hyssop of the family lamiaceae agawa bay agile bold hungry acrobatic scrum squirrel earns a free lunch at our rabbit blanket lake camp agile bold hungry skippy agile bold hungry skippy scrum squirrel gets a free lunch at our rabbit blanket lake camp agile is rarely a free lunch aialik glacier on aialik bay of the pacific ocean air borne euro bungy trampoline kids flying over aspen mountain in white river national forest usa co aspen air float plane tours of mendenhall glacier air float plane tours of mendenhall glacier and the juneau icefield airborne backendering kayaker in cliffhugging narrow drop of the entlen river gorge near gfelle switzerland luzern finsterwald bei entlebuch aircraft ak05glacierbayaktocollegefjordak ak06collegefjordaktosewardak ak07 ak07sewardaktoanchoragedenaliparkak ak08denaliparkaktochenahotspringsak ak09chenahotspringsaktomccarthyak ak10mccarthyaktomoosepassak ak10mccarthyaktomoosepassakk obst photos ak12homeraktohotelalyeskagirdwoodak ak13hotelalyeskagirdwoodaktoachorageak akwdoe akwdoe0 akwdoe02 akwdoe02.05 akwdoe02.08 akwdoe02.15 akwdoe02.16 akwdoe02.20 akwdoe03 akwdoe03.02 akwdoe03.04 akwdoe03.06 akwdoe03.15 akwdoe03.20 akwdoe04 akwdoe04.05 akwdoe05 akwdoe05.02 akwdoe05.11 akwdoe05.13 akwdoe05.22 akwdoe05.26 akwdoe05.30 akwdoe05.31 akwdoe05.32 akwdoe06 akwdoe06.12 akwdoe06.15 akwdoe06.29 akwdoe06.31 akwdoe06.50 alaska best photos alaska best pictures alaska climbing alaska fav photos alaska fave photos alaska favorite photos alaska favorite pictures alaska favs alaska float plane tours alaska helicopter tours alaska hiking alaska photo favorites or favs alaska photos alaska pics alaska pictures alaska sealife center of seward alaska wilderness fav photos alaska wilderness pics alaska wilderness pictures alaska wildlife conservation center alaska wildlife photo favorites or favs alaska wildlife photos alaska yukon ranges and saint elias mountains and fairweather range of alaska usa and the north america continent alaskan adventure photos alaskan best photos alaskan favorite or fav photos alaskan float plane tours alaskan helicopter rides alaskan photos alaskan pics alaskan pictures alaskan red fox alaskan sailing paddlesports sealife magic exploring the inside or inland passage of the pacific ocean's gulf of alaska beyond usa ak ketchikan juneau skagway seward homer alaskan whales dolphins orcas eagles puffins seabirds alaskan whales dolphins orcas eagles puffins seabirds with image alaskan whales dolphins orcas eagles puffins seabirds with images audio video development images alaskan whales dolphins orcas eagles with images audio video alaskan whales wildlife magic or 2016 alaskan whales and wildlife magic video project or awawm vp alaskan whales wildlife magic the pov and sounds that boater's alaskan wilderness pics alaskan wilderness pictures alaskanseawildlifemagic alaskanwildsailing alberta falls dwarfs spectators along glacier gorge trail in rocky mountain national park usa co estes park albino coyote all of the images at this location were captured by robert arthu all of the images at this location were captured by robert arthur obst all of the images in this gallery were captured by creative imagery by imagery creation evangelist robert obst or bob obst of creative imagery by © robert arthur obst all of the images in this gallery were captured by imagery creation evangelist robert obst or bob obst of creative imagery by © robert arthur obst all phases full blood supermoon all the end of a partial lunar eclipse of a 'full blood supermoon' that occurred between about 1023 pm and 1127 pm on the 27 of september 2015 over the pheasant branch creek conservany and the lake mendota waterfront near captain bills restaurant within middleton wi usa fav or favorite obst family outings within southern wisconsin usa usa wi madison middleton all time best daily favorite photos by bob obst all time daily best or favorite photos by bob obst all time favorite photos of bob obst allen marine tours allfinal2 along alpine alyeska resort alyeska resot amazing pictures captued close to home sweet home by bob obst amazing rainbow over lake mendota amazing sunsets wisconsin ambitious hikers and climbers and float plane or helicopter riders enjoy amazing views of snow capped mountains of granite towering over remote fjords within the rugged misty fiords national monument usa alaska ketchikan ambitious hikers and ice climbers and float plane or helicopter riders enjoy blue sky views of remote mountains and rivers of ice from near the middle of twelve miles long mendenhall glacier within tongass national forest ambitious hikers and ice climbers and float plane or helicopter riders may enjoy blue sky views of remote snowy mountains and curving rivers of ice from near the top of twelve miles long mendenhall glacier within tongass national forest usa alaska juneau ambitious hikers and ice climbers and float plane or helicopter riders may enjoy blue sky views of remote snowy mountains and flowing rivers of ice from near the top of twelve miles long mendenhall glacier within tongass national forest usa alaska juneau ambitious hikers and ice climbers and float plane or helicopter riders will enjoy views of the twelve miles long mendenhall glacier within tongass national forest curving to meet auke bay and the pacific ocean usa alaska juneau ambitious hikers and ice climbers and float plane riders can enjoy blue sky views of remote snowy mountains and flowing rivers of ice from near the top of twelve miles long mendenhall glacier within tongass national forest usa alaska juneau ambitious hikers and ice climbers and float plane riders can enjoy views of remote snowy mountains and flowing rivers of ice from near the top of mendenhall glacier usa alaska juneau america american bald eagle of kingdom animalia and phylum chordata and class aves and order accipitriformes and family accipitridae and genus haliaeetus and species haliaeetus leucocephalus american bald eagle on an iceberg within john hopkins inlet and glacier bay national park and preserve usa ak gustavus american bald eagle proudly perched below the west bluff trail above devils lake within devils lake state park american bald eagle soaring directly over me silhouetted by fog near the sterling highway by homer on the western kenai peninsula usa alaska homer american bison approaches grand loop road in hayden valley of yellowstone national park american canoe association instructor training american canoe association midwest division sanctioned canoe kayak competition american family grand canyon dad obst american family insurance agent grand canyon dad robert john obst american family insurance employee picnic american family insurance picnic american lady vanessa virginiensis american youth soccer association madison kids' summer colorful soccer scrum usa wi madison american youth soccer organization americas national parks americasnationalpark americasnationalparks amherst peak amherst peak and coast mountains tower over bald eagles or haliaeetus leucocephalus on a channel marker within lynn canal between admiralty island and auke bay in the pacific ocean north of juneau usa alaska juneau amherst peak and the coast mountains frame a killer whale or orcinus orca that is cruising the lynn canal between admiralty island and auke bay in the pacific ocean usa alaska juneau amnicon falls gorge swim amnicon falls state park amnicon falls state park on the south shore of lake superior amnicon falls state park skiing back country and cross country and nordic amnicon falls state parkon the south shore of lake superior amorphophallus titanum or titan arum or corpse flower or bunga bangkai an evil sky swirls over the wolf river refuge with towering black angry clouds as a tornado passes between lily and hollister north of this location within the wolf river territory an oasis within the center of metropolitan madison crystalline blue skies over lovely shallow pond within the university of wisconsin madison arboretum usa wi madison an orange sunset over maiden lake entertains diners at the maiden lake supper club near the wolf river refuge and wolf river territory ancestral pueblo peoples home ad 600 to ad 1300 ancient inspiring pueblo cliff palace in mesa verde national park usa co mesa verde 81330 ancient lava flows ancient lunar like volcanic landscape along the spatter conestrail within craters of the moon national monument and preserve ancient roque gageac on beautiful and serene dordogne river france aquitaine dordogne cénac et saint julien and a cobalt waters below west bluff trail within devils lake state park and blue skies surround cobalt blue lake of the clouds within porcupine mountains wilderness state park and cerulean skies embrace cobalt blue lake of the clouds within porcupine mountains wilderness state park and cerulean skies frame cobalt blue lake of the clouds within porcupine mountains wilderness state park and crimson marshes frame upper carp river from escarpment trail in lake of the clouds scenic area of porcupine mountains wilderness state park usa mi ontonagon and the quality of its remnants of southern appalachian mountain culture and then full moon again of a full blood supermoon lunar eclipse that occurred between about 639 pm and 1127 pm on the 27 of september 2015 over the pheasant branch creek conservany and the lake mendota waterfront near captain bills restaurant within middleton wi usa fav or favorite obst family outings within southern wisconsin usa usa wi madison middleton andscapes inspirational mountains anglers and whitewater paddlers and hikers view during autumn of a special clear quiet place also called an eddy on the wild wolf river at gilmore's mistake rapids usa wi white lake angry stormy weather over the salt river near alpine wyoming major retirement adventure travel by robert arhtur obst tofrom usa wy 13 to 27 of may 2015 spring into yellowstone events including selfguided tours of yellowstone national park and grand teton national park areas and return to usa wi middleton usa wy alpine anokijig spirit camp anokijig week eight first place contest winner usa wi plymouth ap.qweurope.austria_00011987.09_ss30aug2012_obertilliach.gailrivervalley.lushgreenvalleyu ap.qweurope.austria_00021987.09_ss30aug2012_obertilliach.gailrivervalley.lushgreenvalleyu ap.qweurope.austria_00041987.09_ss30aug2012_obertilliach.gailrivervalley.lushgreenvalleyserpentinefastriveru ap.qweurope.austria_00061987.09_ss30aug2012_obertilliach.gailrivervalley.lushgreenvalleyserpentinefastriveru ap.qweurope.austria_00071987.09_ss30aug2012_obertilliach.gailrivervalley.lushgreenvalleyserpentinefastriveru ap.qweurope.austria_0008.scannedslide_1987.09_obertilliach.gailrivervalley.lushgreenvalleyu ap.qweurope.austria_00111987.09_ss30aug2012_obertilliach.gailrivervalley.churchclocktoweru ap.qweurope.austria_00131987.08.27_ss30aug2012_obertilliach.gailrivervalley.forestedcanyons.kayakersviewu ap.qweurope.austria_00161987.08.27_ss05june2013_obertilliach.gailrivervalley.forestedcanyons.sidestreamwaterfallu ap.qweurope.austria_00171987.09_ss30aug2012_obertilliach.gailrivervalley.lushgreenvalleyserpentinefastriveru ap.qweurope.austria_00191987.09_ss30aug2012_obertilliach.gailrivervalley.lushgreenvalleyserpentinefastriveru apc 2014 dc worlds cksw bronze medalists apc 2014 dc worlds cksw gold medalist final runs apc 2014 dc worlds cksw gold medalist runs apc 2014 dc worlds cksw silver medalists apc 2014 dc worlds cksw team usa apc 2014 dc worlds cksw team usa usa md mchenry apc 2014 dc worlds cksw world champion final runs b b b b b kopliktomasvrzanjakubb b b b gennarogiovannib gennarogiovannib apc2014dcworlds_images.nef apcwolfmantriathlon_images_usa.wi.langlade.wolfriver.s2.canoekayakcompetitorsinsherryrapidsu ape ape at brandenbergerache_09_8sept1987_abran11_sfeao kkb ape at brandenbergerache_15_8sept1987_abran14_odb tbkb ape at brandenbergerache_18_8sept1987_abran25_sfeao tbkscb ape at brandenbergerache_21_8sept1987_abran15_k1 tiefenbkose ape at brandenbergerache_26_8sept1987_abran04_sfeao kaiserkb ape at brandenbergerache_28_8sept1987_abran05 _sfeao kaiserkb ape at brandenbergerache_35_8sept1987_abran07_sfeao kaiserku ape at brandenbergerache_36_8sept1987_abran08_sfeao kaiserkb ape at brandenbergerache_38_8sept1987_abran09_odb kaiserkb ape france sahp onderiver_06_1987 07_fron3_vallouise kayaku ape suisse entlenriver_09_10may1987_sent01_sfeao dropkenderb ape suisse entlenriver_11_10may1987_sent04_kayakingfallsgorgeu ape suisse entlenriver_16_10may1987_sent07_sfeao k1bchokedrb ape suisse lutschineriver_14_24july1987_slut05_middlelutschineb ape suisse lutschineriver_18_24july1987_slut09_sfeao kayakmtnsb ape suisse lutschineriver_26_24july1987_slut16_sfeao k1mmistb apostle islands national lakeshore on lake superior ice caves an apostle islands national lakeshore on lake superior ice caves and ice formations apple river apple river canyon approximate latitude 43.913031 and longitude 102.109909 and altitude 2 approximate location 55.626445 and 130.608673 approximate location of misty fjords national monumnet is 55.626445 and 130.608673 apqwamw_5958_matrorp.p1.usa.wy.moose.grandtetonnp.seakayakeronjennylakeb apqwmw.lim_3977_ato2010.can.bc.field.yohonp.viewfromcanoeonemeraldlakedb apqwmw.lim_4180_ato2010.can.bc.field.yohonp.canoeonemeraldlakedtophatpeakb apqwmw_4173_ob2009.wrrfock.usa.wi.whitelake.canoefollowingeaglewolfriverb apqwmw_8382_ato.westusacanada2014can.bc.field.yohonationalpark.canadianrockies.emeraldlake.canoesb apw wolfriver_1971 08 011_usa wi wrs4 teakettlerapids k1 surfb apwhitewater_5238_wrrock.usa.wi.whitelakewolfriver.sec3_oc1blastingthroughbreakingwavesofgilmoresmistakerapidsat1400cfsb apww_1484_wrrock.keshenawi.wolfriver.s4.oc1approachingupperdropsofdallesofthewolfat744cfs.friskb apww_1496c5_wrrock.keshenawi.wolfriver.s4.oc1rr.opencanoenegotiatesgorgeousdallesofthewolfat744cfs.friskb apww_1502_wrrock.keshenawi.wolfriver.s4.oc1granitecliffsframecanoeinlowerdallesofthewolfat744cfs.frisku apww_1563_ wrrock.keshenawi.opencanoeapproachesfinaldropofbigsmokeyfallsat744cfs.friskcharlieb apww_9122_apcwolfmantriathlon.usa.wi.langlade.wolfriver.s2.canoekayakcompetitorsinsherryrapids.k1wblastingthroughturbulenceb apww_9292_apcwolfmantriathlon.usa.wi.langlade.wolfriver.s2.canoekayakcompetitorsinsherryrapids.opencanoetandemb apww_9425_apcwolfmantriathlon.usa.wi.langlade.wolfriver.s2.canoekayakcompetitorsinsherryrapids.kayaktandemtippingb apww_9481_apcwolfmantriathlon.usa.wi.langlade.wolfriver.s2.canoekayakcompetitorsinsherryrapids.kayakblastingb apww_9572_apcwolfmantriathlon.usa.wi.langlade.wolfriver.s2.canoekayakcompetitorsinsherryrapids.oc2mixedb apww_9736_apcwolfmantriathlon.usa.wi.langlade.wolfriver.s2.canoekayakcompetitorsinsherryrapids.kayakblastingb apww_9797_apcwolfmantriathlon.usa.wi.langlade.wolfriver.s2.canoekayakcompetitorsinsherryrapids.kayaksharkb apww_9869_apcwolfmantriathlon.usa.wi.langlade.wolfriver.s2.canoekayakcompetitorsinsherryrapids.kayakb apwwc apwwc_4832_usa.wi.wausau2012icfjunu23worlds.fgbr.c1t.jun.g2123.29abc.ibbotsonsamuelabbottthomashoustonandrewu apwwqw_1548_ wrrock.keshenawi.canoesweetrouteoverbigsmokeyfallsat744cfs.bobobstb architecture of vancouver british columbia canada architecture of vancouver british columbia canada buildings arctic adventures glacier rider's 4 wheel driving and snowmobiling view during august of the langjökull glacier guarded kerlingafjöll mountain range within the icelandic highlands and the arnarvatnsheidi kjolur area of western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 4 august 2015 arctic adventures glacier rider's 4 wheel driving and snowmobiling view during august of the rugged kerlingafjöll mountain range within the icelandic highlands and the arnarvatnsheidi kjolur area of western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 4 august 2015 arctic adventures glacier rider's 4 wheel driving and snowmobiling view during august of the rugged snowy kerlingafjöll mountain range within the icelandic highlands and the arnarvatnsheidi kjolur area of western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 3 august 2015 arctic adventures glacier rider's view of the rugged landscapes that embrace the kerlingafjöll mountain range within the icelandic highlands and the arnarvatnsheidi kjolur area of western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 4 august 2015 arlington national cemetery arlington national cemetery arlington virginia 22211 tomb of the unknown soldier armory old red gym built in 1894 on langdon street aromatic giant hyssop or agastache scrophularlaefolia plants attract nectar loving insects during the summer within longenecker gardens of the university of wisconsin madison arboretum usa wi madison around the campfire enjoying spectacular fireworks over the village of white lake during the fourth of july celebrations 2012 usa wi white lake arthur robert obst and elysia noelle obst enjoying their view of mountains of obsidian and rhyolite guarding the canyon along the rugged trail that follows a tributary of the tungnaa river between the landmannalaugar area camp and mount blahnukur within south western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 5 august 2015 arthur robert obst by the avalanche creek gorge along the nature trail of the cedars within the avalanche creek area near goingtothesun road upstream of mcdonald lake within glacier national park arthur robert obst celebrating his 'arctic adventures glacier ride' over langjökull glacier and over the kerlingafjöll mountain range within the icelandic highlands and the arnarvatnsheidi kjolur area of western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 4 august 2015 arthur robert obst enjoying a view of the pools of the blesi or the blazer within the colorful geysir hot springs area of south western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 4 august 2015 arthur robert obst enjoying some sunny reading and relaxation time on the sheltered bay by the docking area on the atlantic ocean at landeyjasandur waiting for the landeyjasandur to vestmannaeyjar on heimaey island ferry within south western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 5 august 2015 arthur robert obst on the trail between the landmannalaugar area camp and 3100 ft mount blahnukur within south western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 5 august 2015 arthur robert obst snorkeling through the pure icy and colorful lava tube canyon and lake pingvallavatn during his 'black and blue lava cave' snorkeling adventure with arctic adventures within pingvellir national park and western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 3 august 2015 arthur robert obst with a spectacular view of the gullfoss waterfall on the hvita or white river within western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 4 august 2015 as sun chases fog away american eagles soar over wildflowers and kachemak bay near the sterling highway and homer upon the kenai peninsula usa alaska homer as sun chases fog away over wildflowers and kachemak bay near the sterling highway and homer upon the kenai peninsula usa alaska homer at at high flow boiling moving water alternates with thundering rapids framed by gorgeous canyons along the colorado river within grand canyon national park usa az grand canyon at retirement program at retirement program sharegroup at httpwww.robertarthurobstp at retirement program sharegroup at httpwww.robertarthurobstphotos.comshareefekb4ntdggqe at usa tx southpadreisland_0199_funhogsparaglidingoverspi d1b atatf.usa.ak_7586 _ato2011ak3juneauaktoskagwayak.mendenhallglacierbyfloatplane.curvingmendenhallglaicerofthejuneauicefieldtopacificoceanb atatf_9165_np.ato2011.usa.akak08denaliparkaktochenahotspringsak.denalinp.denalipkrd.reflectionsofdenaliinwonderlakeb atbodf.ato2011.usa.ak_7797_ato2011ak3juneauaktoskagwayak.allenmarinetourswhalewatching.boatersviewofcoastmountainshumpbackwhalesbubblenetfeedingu atdf_8380_ak04.skagwayaktoglacierbayak.usa.ak.gustavus.glaciernpap.glacierbay.blueskiesovermargerieglaciertarrinletnearmtturnerb ate.ato2011.usa.ak_9686c_ato2011ak2vancouverbccantoketchikanak.mistyfjordsnmbyfloatplane.airborneovermountainlakesandmarshlandsb ate.ato2011.usa.ak_9898_ato2011ak3juneauaktoskagwayak.mendenhallglacierbyfloatplane.mountainsamherstpeakjuneauicefieldb athabasca glacier segment 2010 august. views and hiking with arthur robert obst and elysia noelle obst by the athabasca glacier of the columbia icefield area within jasper national park near jasper alberta canada 2010 15 to 31 of august obst family adventure travel program within the usa west mt and canada alberta british columbia within the canadian rockies near the icefields parkway images by imagery creation evangelist robert arthur obst usa id mt can alberta bc athabasca river to slave river to great slave lake to mackenzie river to arctic ocean athletic teenage hiker finds a perfect perch among baraboo quartzite boulders and colorful foliage above the tumbled rocks trail within devils lake state park ato2010 ato2011ak04 ato2011ak04_7908_skagwayaktoglacierbayak.usa.ak.skagway.klondikegoldrushinthp.whitepasstrainarrivinginskagwayu ato2011ak04skagwayaktoglacierbayak ato2011ak1 vancouver british columbia canada to ketchikan alaska usa ato2011ak1vancouverbccantoketchikanak.midnightsunoverinlandpassagenorthofvancouver.orangesunsetfromcruiseship ato2011ak2 vancouver british columbia canada to ketchikan alaska usa ato2011ak2ketchikanaktojuneauak ato2011ak2vancouverbccantoketchikanak.mistyfjordsnmbyfloatplane.mountainsencirclehiddenvalleylakewaterfall ato2011ak3juneauaktoskagwayak atowestcanada_3541y_of2010.can.ab.jaspernationalpark.athabascaviewshikewitharoenou atowestcanada_797435307986353579913536_of2010.can.ab.jaspernationalpark.athabascaviewshikewitharoenoc atowestcanada_nnnn_of2010.can.ab.jaspernationalpark.athabascaviewshikewitharoenou atusamtgnp_2730_mountaingoatsbyhighlinetrailb august 1984 auke bay juneau alaska usa auke bay pacific ocean austria auto and hiking tour drive out and return by robert arthur obst auto and hiking tour drive out and return by robert arthur obst between 12 of may 2015 and 27 of may 2015 tofrom usa wy mt the grearter yellowstone national park ecosystem including grand teton national park and the snakegrayssalt river systems with harry robert house and jan hansen near alpine wy and badlands national park within sd autumn autumn beauty and blue skies frame hikers and photographers on balanced rock trail within devils lake state park usa wi baraboo autumn beauty and cliffs frame cobalt blue lake of the clouds within porcupine mountains wilderness state park autumn beauty and colorful granite escarpments embrace hikers and rock climbers on balanced rock trail within devils lake state park autumn beauty and granite escarpments encircle cobalt blue lake of the clouds within porcupine mountains wilderness state park autumn beauty and roaring pwhitewater frames the approach to presque isle river's manido falls within porcupine mountains wilderness state park autumn beauty and roaring whitewater frames the approach to presque isle river's manido falls within porcupine mountains wilderness state park autumn beauty and whitewater frames the approach to presque isle river's manido falls within porcupine mountains wilderness state park autumn beauty and whitewater on the west branch of the ontonagon river autumn beauty and whitewater on the wolf river autumn beauty borders west hollister road near the wild wolf river and hollister images from the best of environment and nature and outings near the wolf river refuge within the wolf river territory of northeastern wisconsin usa usa wi langlade autumn beauty embraces grand teton mountain southwest of the jenny lake visitor's center within grand teton national park autumn beauty embraces hikers and rock climbers on balanced rock trail within devils lake state park usa wi baraboo autumn beauty embraces mount saint john northwest of jenny lake within grand teton national park autumn beauty frames section 2 of the wild wolf river at hollister near the start of burnt point rapids images from the best of environment and nature and outings near the wolf river refuge within the wolf river territory of northeastern wisconsin usa usa wi langlade autumn beauty frames the approach to the presque isle river within porcupine mountains wilderness state park autumn beauty frames the ferry blluff state natural area within the lower wisconsin state riverway images from the best of environment and nature andor favorite obst family outings within sixty miles or 60 mi or about an hour drive of the madison and middleton areas near sauk city within southwestern wisconsin usa usa wi sauk city autumn beauty frames the lower wisconsin state riverway near the ferry blluff state natural area images from the best of environment and nature andor favorite obst family outings within sixty miles or 60 mi or about an hour drive of the madison and middleton areas near sauk city within southwestern wisconsin usa usa wi sauk city autumn beauty frames the presque isle river's manido falls autumn beauty frames the wild wolf river at boy scouts rapids images from the best of environment and nature and outings near the wolf river refuge within northeastern wisconsin usa usa wi white lake autumn beauty frames the wild wolf river at boy scouts rapids images from the best of environment and nature andor favorite obst family outings near the wolf river refuge within northeastern wisconsin usa usa wi white lake autumn beauty frames the wild wolf river near the start of boy scouts rapids at the gardner dam boy scouts camp images from the best of environment and nature and outings near the wolf river refuge within the wolf river territory of northeastern wisconsin usa usa wi white lake autumn beauty frames the wild wolf river near the start of boy scouts rapids images from the best of environment and nature and outings near the wolf river refuge within the wolf river territory of northeastern wisconsin usa usa wi white lake autumn beauty lake superior circle tour adventures autumn beauty reflections along rose lake near the nicolet national forest road 2120 and the rose lake boat landing images from the best of environment and nature and outings near the wolf river refuge within the wolf river territory of northeastern wisconsin usa usa wi langlade autumn beauty surrounds presque isle river's manabezho falls within porcupine mountains wilderness state park autumn color frames the presque isle river's nawadaha falls within porcupine mountains wilderness state park usa mi ontonagon autumn color photos autumn color photos faves autumn color photos favorites autumn color tour 2011 autumn colors autumn colors and blue skies and fresh snow highlight the foliage along us highway 441 or newfound gap road within great smoky mountains national park usa nc tn gatlinburg autumn colors and boiling whitewater frame an open canoe at high flows in twenty day rapids on section three of the national wild and scenic wolf river autumn colors and boiling whitewater frame an open canoe in twenty or 20 day rapids on section 3 of the national wild and scenic wolf river usa wi white lake autumn colors and granite outcrops frame bob obst kayaking big or high falls on the south fork of the jump river at big falls county park usa wi kennan autumn colors crowning lake of the clouds autumn colors crowning upper carp river autumn colors crowns lake of the clouds autumn colors frame an american bald eagle proudly perched near devils lake's west bluff trail within devils lake state park autumn colors frame open canoe in 20 day rapids on section 3 of the wild wolf river usa wi white lake autumn colors over big smokey falls within menominee indian nation on the wild wolf river near keshena autumn colors over big smokey falls within menominee indian nation on the wild wolf river near white lake usa wi white lake autumn colors over big smokey falls within menominee indian nation on the wild wolf river within northeastern wisconsin near keshena autumn colors over big smokey falls within menominee indian nation on the wild wolf river within northeastern wisconsin near keshena usa wi keshena autumn colors surround an american bald eagle perched near devils lake's west bluff trail within devils lake state park autumn colors woods just north of boy scouts rapids autumn crimson sunset over the wild wolf river near the wolf river refuge within northeastern wisconsin autumn eagle devils lake state park hiking west bluff trail autumn eagle devils lake state park hiking west bluff trail usa wi baraboo dlsp autumn flaming foliage and cerulean skies embrace aquamarine devils lake near east bluff trail within devils lake state park autumn flaming foliage and cerulean skies embrace cobalt blue devils lake near east bluff trail within devils lake state park autumn flaming foliage and cerulean skies frame aquamarine devils lake by west bluff trail within devils lake state park autumn flaming foliage and cerulean skies frame aquamarine devils lake near west bluff trail within devils lake state park autumn foliage autumn foliage and bright blue skies embrace the rugged and crystalline cascade river upstream of the mn highway 61 bridge within cascade river state park recreation area autumn foliage and bright blue skies embrace the rugged course of the cascade river upstream of the mn highway 61 bridge within cascade river state park usa mn lutsen autumn foliage and cerulean skies frame aquamarine devils lake by west bluff trail within devils lake state park autumn foliage and cerulean skies frame devils lake from west bluff trail within devils lake state park autumn foliage and clear blue skies frame the historic state capitol of wisconsin of madison autumn foliage and clear blue skies frame the state of wisconsin capitol in resplendent glory usa wi madison autumn foliage and lichen covered river birch frame roaring presque isle river's manido falls within porcupine mountains wilderness state park usa mi ontonagon autumn foliage encircles a fishing boat on otter lake autumn foliage frame brownstone falls of the tyler forks river as it leaps into the bad river gorge within copper falls state park autumn foliage frames a kayaker on the wild wolf river within boy scouts rapids by the gardner dam boy scout camp best of environment and nature for the wrr or wolf river refuge area on the banks of the wild wolf river within the wolf river territory near langlade wisconsin usa usa wi langlade autumn foliage frames lake of the clouds and the lower carp river within porcupine mountains wilderness state park usa mi ontonagon autumn foliage frames the cascade river falls upstream of the mn highway 61 bridge along the superior hiking trail within cascade river state park usa mn lutsen autumn foliage frames the wild upper wolf river at hollister best of environment and nature for the wrr or wolf river refuge area on the banks of the wild wolf river within the wolf river territory near langlade wisconsin usa usa wi langlade autumn foliage frames the wild upper wolf river near hollister best of environment and nature for the wrr or wolf river refuge area on the banks of the wild wolf river within the wolf river territory near langlade wisconsin usa usa wi langlade autumn foliage frames the wild wolf river within boy scouts rapids by the gardner dam boy scout camp best of environment and nature for the wrr or wolf river refuge area on the banks of the wild wolf river within the wolf river territory near langlade wisconsin usa usa wi langlade autumn foliage framing the wild wolf river as it races through boy scouts rapids by the gardner dam boy scout camp best of environment and nature for the wrr or wolf river refuge area on the banks of the wild wolf river within the wolf river territory near langlade wisconsin usa usa wi langlade autumn foliage framing the wild wolf river near the wolf river refuge best of environment and nature for the wrr or wolf river refuge on the banks of the wild wolf river within the wolf river territory near langlade wisconsin usa usa wi langlade autumn folliage and sunlight dappled water highlight the west prong of the little pigeon river near the sugarlands visitor center and us highway 441 or newfound gap road within great smoky mountains national park usa nc tn gatlinburg autumn folliage covers the chimney tops mountain near us highway 441 or newfound gap road within great smoky mountains national park during autumn usa nc tn gatlinburg autumn folliage covers the rolling mountains at the carlos c. campbell overlook near us highway 441 or newfound gap road within great smoky mountains national park during autumn usa nc tn gatlinburg autumn glory along the lower wisconsin state riverway from the ferry blluff state natural area images from obst family outings within sixty miles or 60 mi or about an hour drive of the madison and middleton areas near sauk city within southwestern wisconsin usa usa wi sauk city autumn glory along the sparkling wild wolf river within section 2 at sherry rapids between the irrigation hole and langlade images from the best of environment and nature and outings near the wolf river refuge within the wolf river territory of northeastern wisconsin usa usa wi langlade autumn glory along the wild wolf river at boy scouts rapids within gardner dam boy scouts camp images from the best of environment and nature and outings near the wolf river refuge within the wolf river territory of northeastern wisconsin usa usa wi white lake autumn glory along the wild wolf river by boy scouts rapids within gardner dam boy scouts camp images from the best of environment and nature and outings near the wolf river refuge within the wolf river territory of northeastern wisconsin usa usa wi white lake autumn glory along the wild wolf river near the start of the second major pitch of boy scouts rapids within gardner dam boy scouts camp images from the best of environment and nature and outings near the wolf river refuge within the wolf river territory of northeastern wisconsin usa usa wi white lake autumn glory arches over a trail runner within indian lake park of dane county fav or favorite obst family outings within sixty miles or 60 mi or about an hour drive of the madison and middleton areas within southern wisconsin usa usa wi cross plains autumn glory arches over a wonderful woodland trail within indian lake park of dane county fav or favorite obst family outings within sixty miles or 60 mi or about an hour drive of the madison and middleton areas within southern wisconsin usa usa wi cross plains autumn glory embraces the trails of indian lake park of dane county images from fav or favorite obst family outings within sixty miles or 60 mi or about an hour drive of the madison and middleton areas within southern wisconsin usa usa wi cross plains autumn glory embracing the lower wisconsin state riverway by the ferry blluff state natural area images from obst family outings within sixty miles or 60 mi or about an hour drive of the madison and middleton areas near sauk city within southwestern wisconsin usa usa wi sauk city autumn glory embracing the lower wisconsin state riverway by the ferry blluff state natural area images from obst family outings within sixty miles or 60 mi or about an hour drive of the madison and middleton areas within southern wisconsin usa usa wi sauk city autumn glory embracing the lower wisconsin state riverway from the ferry blluff state natural area images from obst family outings within sixty miles or 60 mi or about an hour drive of the madison and middleton areas near sauk city within southwestern wisconsin usa usa wi sauk city autumn glory fully embracing the lower wisconsin state riverway by the ferry blluff state natural area images from obst family outings within sixty miles or 60 mi or about an hour drive of the madison and middleton areas near sauk city within southwestern wisconsin usa usa wi sauk city autumn glory fully embracing the lower wisconsin state riverway by the ferry blluff state natural area images from obst family outings within sixty miles or 60 mi or about an hour drive of the madison and middleton areas within southern wisconsin usa usa wi sauk city autumn gorgeous reflections under blue skies over otter lake usa wi elcho autumn gorgeous reflections under blue skies over otter lake within the wolf river watershed autumn hardwoods autumn hardwoods glory arching over a wonderful woodland trail within indian lake park of dane county fav or favorite obst family outings within sixty miles or 60 mi or about an hour drive of the madison and middleton areas within southern wisconsin usa usa wi cross plains autumn hardwoods over wolf river autumn in all of its glory embraces the lower wisconsin state riverway by the ferry blluff state natural area images from obst family outings within sixty miles or 60 mi or about an hour drive of the madison and middleton areas within southern wisconsin usa usa wi sauk city autumn in spectacular glory embraces the lower wisconsin state riverway by the ferry blluff state natural area images from obst family outings within sixty miles or 60 mi or about an hour drive of the madison and middleton areas within southern wisconsin usa usa wi sauk city autumn leaves and cerulean skies frame aquamarine devils lake by west bluff trail within devils lake state park autumn leaves and cerulean skies frame aquamarine devils lake off west bluff trail within devils lake state park autumn magic crowns gnarled sugar maple with golden crown by east bluff trail in devils lake state park usa wi baraboo autumn magic frames a winding wolf river with flaming foliage above sherry rapids autumn magic frames open canoe and wisconsin's winding wolf river with flaming foliage above sherry rapids autumn magic reflections at sunset over mueller lake near polar usa wi polar autumn magic reflections at sunset over mueller lake within northeastern wisconsin near polar autumn oaks autumn oaks and clear blue skies frame the national historic landmark state of wisconsin capitol in its resplendent glory usa wi madison autumn oaks and clear blue skies frame the state of wisconsin capitol in its resplendent glory usa wi madison autumn oaks and quartzite boulders and blue skies frame devils lake along the ice age national scenic and balanced rock trails within southeastern devils lake state park usa wi baraboo autumn oaks and rugged shorelines frame devils lake along ice age national scenic and balanced rock trails within southeastern devils lake state park usa wi baraboo autumn peeking at canoeists paddling the crystalline picturesque upper wolf river between lily and wolf river landing in wisconsin autumn reflections and cobalt skies over serene otter lake near elcho usa wi elcho autumn reflections at sunset over mueller lake near polar usa wi polar autumn reflections at sunset over mueller lake within northeastern wisconsin near polar autumn reflections under blue skies over the wisconsin river headwaters near lake lac vieux desert usa wi land o'lakes autumn sugar maple magic light autumn sunrise highlights eagles totem pole at lutsen resort on lake superior usa mn lutsen autumn sunrise over lake superior at lutsen resort usa mn lutsen autumn sunset over the grand teton mountains from snake river overlook within grand teton national park autumn trees autumn turning into an early winter over a frosty wild wolf river section 2 by the wolf river refuge autumn woodlands of the nicolet naitonal forest frame rose lake best of environment and nature for the wrr or wolf river refuge area on the banks of the wild wolf river within the wolf river territory near langlade wisconsin usa usa wi langlade autumn woodlands of the nicolet naitonal forest frames rose lake best of environment and nature for the wrr or wolf river refuge area on the banks of the wild wolf river within the wolf river territory near langlade wisconsin usa usa wi langlade autumn woods guarding the wild wolf river near the wolf river refuge best of environment and nature for the wrr or wolf river refuge on the banks of the wild wolf river within the wolf river territory near langlade wisconsin usa usa wi langlade autumncolorframesclearwatersofaspecialplace autumncolors avalanche creek roars along avalanche creek trail east of goingtothesun road within glacier national park avalanche of china snow pekin lilac tree blooms in longenecker gardens of the university of wisconsin madison arboretum usa wi madison avalanche of china snow pekin lilac tree flowers in longenecker gardens of the university of wisconsin madison arboretum usa wi madison aw1 aw1.02 aw1.03 aw1.04 aw1.05 aw1.06 aw1.08 aw1.09 aw1.10 aw1.11 aw1.13 aw1.14 aw1.15 aw1.16 aw1.17 aw1.18 aw1.20 aw1.20b aw1.20c aw1.20d aw1.21 aw1.22 aw1.23 aw1.24 aw1.25 aw1salilingalaska ayso madison kids' soccer scrum usa wi madison az azaleas or kingdom plantae and angiosperms and eudicot and asterids and order ericales and family ericaceae genus rhododendron and subgenus pentanthera and tsutsuji b11 back country skier's and snowshoer's precipitous view during winter of a frozen potowatomi falls and canyon on the national wild and scenic black river within the black river recreation area of the ottawa national forest usa mi bessemer back country skier's and snowshoer's precipitous winter view of frozen potowatomi falls and the gorge below on the national wild and scenic black river within the black river recreation area of the ottawa national forest back country skier's and snowshoer's view during winter of a frozen and snow covered gorge falls and its canyon below on the national wild and scenic black river within the black river recreation area of the ottawa national forest back country skier's and snowshoer's view during winter of a frozen gorge falls and its canyon below on the national wild and scenic black river within the black river recreation area of the ottawa national forest usa mi bessemer back country skier's and snowshoer's view during winter of a frozen gorge falls and the canyon below on the national wild and scenic black river within the black river recreation area of the ottawa national forest usa mi bessemer back country skier's and snowshoer's view during winter of a frozen rainbow falls and the canyon above on the national wild and scenic black river within the black river recreation area of the ottawa national forest usa mi bessemer back country skier's and snowshoer's view during winter of hemlock trees framing frozen potowatomi falls on the national wild and scenic black river within the black river recreation area of the ottawa national forest usa mi bessemer back country skier's and snowshoer's view during winter of the canyon immediately downstream of rainbow falls on the national wild and scenic black river within the black river recreation area of the ottawa national forest usa mi bessemer back country skier's and snowshoer's view during winter of the icy sandstone gorge immediately below gorge falls on the national wild and scenic black river within the black river recreation area of the ottawa national forest usa mi bessemer back country skier's and snowshoer's winter view of frozen potowatomi falls and the gorge below on the national wild and scenic black river within the black river recreation area of the ottawa national forest usa mi bessemer back country skiing and snowshoeing on national recreation trails within the black river recreation area of michigan back country skiing and snowshoeing on national recreation trails within the black river recreation area of the upper peninsula of michigan backendering a whitewater slalom solo decked canoe backpaddlingseakayakerswithhumpbackwhales backpaddlingseakayakerswithhumpbackwhales1 backroads of northern maine near baxter state park and allagash wilderness waterway state park bad river gorge about two thirds mile below twenty nine foot copper falls at high flows badgercamp badlands badlands national park baerhowie balanced rock and ice age national scenic trails hiker's view of blue skies and golden trees framing the southern shores of devils lake within devils lake state park usa wi baraboo balanced rock trail balanced rock trail segment of the ice age national scenic trail within devils lake state park bald eagle or haliaeetus leucocephalus sighting on section 3 of bald eagle or haliaeetus leucocephalus sighting on section 3 of the wild wolf river between twenty day rapids and boy scout rapids within langlade country wisconsin usa wi langlade bald eagle or haliaeetus leucocephalus sighting on section 3 of the wild wolf river between twenty day rapids and boy scouts rapids within langlade country wisconsin usa wi langlade bald eagle or haliaeetus leucocephalus soaring above me explor bald eagle or haliaeetus leucocephalus soaring above me exploring the sounds and inland passages of alaska to views of whales and dolphins and eagles within the gulf of alaska of the pacific ocean between ketchikan and homer alaska during july of 2011 usa ak juneau homer bald eagle or haliaeetus leucocephalus soaring over the kachemak bald eagle or haliaeetus leucocephalus soaring over the kachemak bay state critical habitat area near homer alaska exploring the sounds and inland passages of alaska to views of whales and dolphins and eagles within the gulf of alaska of the pacific ocean between ketchikan and homer alaska during july of 2011 usa ak homer bald eagle soars over oxbow on section 2 of the wild wolf river usa wi white lake bald eagles or haliaeetus leucocephalus on a channel marker within lynn channel between admiralty island and auke bay in the pacific ocean north of juneau usa alaska juneau bald eagles or haliaeetus leucocephalus within auke bay near juneau alaska crusing the sounds and inland passages to views of whales and dolphins and eagles within the gulf of alaska of the pacific ocean between ketchikan and haines alaska during july of 2011 usa ak juneau bald ridge photography tour with kathy lichtendahl usa wy cody chamber of commercesponsored spring into yellowstone event ballooning banff national park icefields parkway big bend banff national park mistaya river canyon banff national park of canada johnston creek johnston canyon upper falls baraboo baraboo pink quartzite baraboo quartzite baraboo quartzite cliffs baraboo quartzite cliffs autumn foliage and blue skies frame an aquamarine devils lake from west bluff trail within devils lake state park baraboo quartzite outcrops baraboo quartzite pink cliffs baraboo river to wisconsin river to mississippi river to gulf of mexico baraboodlspphotocontest1march2011_9010_liab.usa.wi.mmo.baraboo.dlsp.devilslake.wbtbc basel renn paddlers club 'one of the most difficult whitewater rivers in switzerland' basketball with stars be nimble be bold be balanced be innovative be courageous be motivated or hungry be flexible be agile bearcat mountain beautiful braided chitina river valley south of nizina glacier within wrangell st. elias national park and preserve usa alaska mccarthy beautiful brooding spring skies over canoeist on section 3 of the wild wolf river between langlade and twenty day rapids usa wi white lake beautiful grasslands and rugged foothills encircle denali or mount mckinley within denali national park usa alaska denali park beautiful reflections of denali or mount mckinley and its forests in wonder lake within denali national park usa alaska denali park beauty beauty creek wilderness youth hostel hi along along the ice fields parkway in jasper national park alberta canada beauty creek wilderness youth hostel hi along the ice fields parkway in jasper national park alberta canada beauty creek wilderness youth hostel within jasper national park canada alberta jasper beaver station lake near watersmeet michigan beertoss beginning of an eruption of the strokkur geysir or 'the churn' within the colorful geysir hot springs area of south western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 4 august 2015 below beluga whale merandus bemans spuriosious bermans best best alaska photos best alaska wildlife photos best alaskan photos best alaskan wildlife photos best autumn color photos best environment nature best of bob obst daily photos best of environment and nature for the wrr or wolf river refuge on the banks of the wild wolf river within the wolf river territory near langlade wisconsin usa best of the athabasca river valley canada alberta jasper best of wings airways best or fav images of arthur robert obst best photos hostels best photos of aro best rivers of michigan best rivers of wisconsin best scarlet sunset best whitewater photos best wolf river photos bhphotocold bib 11 anton franz of germany final rank 3 out of 51 racing in the c1 canoe single men slalomwhitewater final runs on 20 sept 2014 at the 2014 'deep creek' world championships within the adventure sports center international or asci site near deep creek lake and mchenry md usa bib number 1 schubert sebastian of germany rank 2 out of 40 exploding with power through gate 12 during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 12 labarelle pierre and peschier nicolas of france final rank 5 out of 38 charging in the slalom whitewater course in tandem canoe men or c2 during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 12 labarelle pierre and peschier nicolas of france final rank 5 out of 38 submerged on the slalom whitewater course in tandem canoe men or c2 during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 13 behling robert and becker thomas of germany final rank 13 out of 38 charging in the slalom whitewater course in tandem canoe men or c2 during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 13 kurt michael of switzerland rank 26 out of 40 stern pivoting through gate 12 during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 14 brzezinski filip and brzezinski andrzejof of poland final rank 4 out of 38 charging through the slalom whitewater course in tandem canoe men or c2 during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 15 grimm alexander of germany final rank 28 out of 40 blasting through foam during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 15 mueller kai and mueller kevin of germany final rank 14 out of 38 dancing through the slalom whitewater course in tandem canoe men or c2 during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 15 mueller kai and mueller kevin of germany final rank 14 out of 38 squeezing through the slalom whitewater course in tandem canoe men or c2 during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 15 mueller kai and mueller kevin of germany final rank 14 out of 38 submerging on the course in tandem canoe men or c2 slalom whitewater during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 17 clarke joseph of great britain final rank 36 out of 40 powering through gate 13 during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 17 clarke joseph of great britain final rank 36 out of 40 with determined paddling past gate 14 during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 17 kuznetsov mikhail and larionov dmitry of russia final rank 23 out of 38 squeezing through the slalom whitewater course in tandem canoe men or c2 during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 17 kuznetsov mikhail and larionov dmitry of russia final rank 23 out of 38 surfing on the slalom whitewater course in tandem canoe men or c2 during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 18 de gennaro giovanni of italy final rank 8 out of 40 charging during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 18 de gennaro giovanni of italy final rank 8 out of 40 vertical paddle power stroking during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 18 marzo daniel and perez jesus of spain final rank 8 out of 38 power twisting through the slalom whitewater course in tandem canoe men or c2 during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 20 mcewan devin and eichfeld casey of the usa final rank 15 out of 38 power charging through the slalom whitewater course in tandem canoe men or c2 during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 20 mcewan devin and eichfeld casey of the usa final rank 15 out of 38 power squeezing through the slalom whitewater course in tandem canoe men or c2 during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 20 mcewan devin and eichfeld casey of the usa final rank 15 out of 38 powering through the slalom whitewater course in tandem canoe men or c2 during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 20 mcewan devin and eichfeld casey of the usa final rank 15 out of 38 with a twisting dance through the slalom whitewater course in tandem canoe men or c2 during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 21 halcin martin of the slovak republic final rank 11 out of 40 blasting through foam during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 21 halcin martin of the slovak republic final rank 11 out of 40 charging during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 21 halcin martin of the slovak republic final rank 11 out of 40 with a power peel off from an eddy during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 21 halcin martin of the slovak republic final rank 11 out of 40 with power vertical twisting through gate 15 during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 22 brus simon of slovenia final rank 32 out of 74 charging through the course in kayak men or k1 slalom whitewater during his qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 22 davies rhys and lister matthew of great britain final rank 7 out of 38 blasting through the slalom whitewater course in tandem canoe men or c2 during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 22 davies rhys and lister matthew of great britain final rank 7 out of 38 power surfing through the slalom whitewater course in tandem canoe men or c2 during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 23 koplik tomas and vrzan jakub of the czech republic final rank 12 out of 38 with a balancing act within the slalom whitewater course in tandem canoe men or c2 during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 23 polaczyk rafal of poland rank 7 out of 40 dancing with waves during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 24 bersinger thomas of argentina final rank 6 out of 40 power carving through waves during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 24 hodson ethan and jeffery robin of austria final rank 31 out of 38 charging through the slalom whitewater course in tandem canoe men or c2 during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 24 hodson ethan and jeffery robin of austria final rank 31 out of 38 with a balancing act within the slalom whitewater course in tandem canoe men or c2 during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 24 hodson ethan and jeffery robin of austria final rank 31 out of 38 with a twisting dance within the slalom whitewater course in tandem canoe men or c2 during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 25 correa charles and oliveira anderson of brazil final rank 24 out of 38 balancing through the course in canoe double men or c2 slalom whitewater during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 25 correa charles and oliveira andersonof switzerland final rank 24 out of 38 dancing through the course in canoe double men or c2 slalom whitewater during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 26 romeo andrea of italy final rank 30 out of 40 charging during the kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 26 romeo andrea of italy final rank 30 out of 40 peeling off during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 26 romeo andrea of italy final rank 30 out of 40 submerging during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 26 werro lukas and werro simon of switzerland final rank 30 out of 38 dancing through the course in canoe double men or c2 slalom whitewater during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 27 ye yongtao and huang yongze of china final rank 27 out of 38 charging through the course in canoe double men or c2 slalom whitewater during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 27 ye yongtao and huang yongze of china final rank 27 out of 38 dancing through the course in canoe double men or c2 slalom whitewater during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 28 sajbidorjan of the slovak republic final rank 29 out of 40 going for it in kayak single men slalom whitewater during his semifinal heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 28 zhang hang and deng xiao of japan final rank 26 out of 38 blasting through the course in canoe double men or c2 slalom whitewater during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 3 florence david and hounslow richard of great britain final rank 22 out of 38 squeezing through the slalom whitewater course in tandem canoe men or c2 during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 3 polaczyk mateusz of poland final rank 7 out of 74 charging through the course in kayak men or k1 slalom whitewater during his qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 3 team france biazizzo mathieu and combot sebastien and neveu boris final rank 1 out of 18 racing in the teams k1 kayak single men slalomwhitewater final 20 sept 2014 start time 1547 at the 2014 'deep creek' icf or international canoe federation world championships within the adventure sports center international or asci site near deep creek lake and mchenry md usa bib number 30 dawson michael of new zealand final rank 12 out of 40 power stern pivoting during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 30 dawson michael of new zealand final rank 12 out of 40 stern squirting through gate 13 during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 30 dawson michael of new zealand final rank 12 out of 40 wave blasting during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 30 dawson michael of new zealand final rank 12 out of 40 wave crashing during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 30 dawson michael of new zealand final rank 12 out of 40 with a chestful of foam during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 30 sasaki shotaand sasaki tsubasaof japan final rank 29 out of 38 going for it in canoe double men or c2 slalom whitewater during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 31 hayward ben and smedley cameron of canada final rank 33 out of 38 going for it in canoe double men or c2 slalom whitewater during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 31 merritt jaxon of australia final rank 38 out of 40 with a faceful of foam during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 32 yu hongmin and chen jin of china final rank 28 out of 38 going for it in canoe double men or c2 slalom whitewater during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 34 hurd eric and larimer jeff of the usa final rank 32 out of 38 going for it in canoe double men or c2 slalom whitewater during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 35 rossi lucas and rossi sebastian of argentina final rank 36 out of 38 going for it in canoe double men or c2 slalom whitewater during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 36 hounslow richard of great britain final rank 15 out of 40 dancing with waves during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 36 munhoz wellington and vieira cassiano of brazil or bra final rank 34 out of 38 going for it in canoe double men or c2 slalom whitewater during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 38 hermans maarten of the netherlands final rank 23 out of 40 blasting through gate 12 during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 38 hermans maarten of the netherlands final rank 23 out of 40 with determined charging during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 38 mccleskey scott and fraker benn of the usa final rank 35 out of 38 blasting through the course in tandem canoe men or c2 slalom whitewater during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 38 mccleskey scott and fraker benn of the usa final rank 35 out of 38 dancing through the course in tandem canoe men or c2 slalom whitewater during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 4 prskavec jiri of the czech republic rank 18 out of 40 stern squirting within gate 14 during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 4 prskavec jiri of the czech republic rank 18 out of 40 wave carving after gate 14 during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 4 team czech republic prskavec jiri and hradilek vavrinec and prindis vit final rank 2 out of 18 racing in the teams k1 kayak single men slalomwhitewater final 20 sept 2014 start time 1547 at the 2014 'deep creek' icf or international canoe federation world championships within the adventure sports center international or asci site near deep creek lake and mchenry md usa bib number 4 team slovenia savsek benjamin and bozic luka and bercic anze final rank third out of eleven teams negotiating the c1 canoe single men slalomwhitewater team slalomwhitewater final 20 sept 2014 start time 1450 at the 2014 'deep creek' icf or international canoe federation world championships within the adventure sports center international or asci site near deep creek lake and mchenry md usa bib number 42 silva pedro of brazil final rank 40 out of 40 powering through a gate during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 5 team great britain hounslow richard and clarke joseph and brady thomas final rank 3 out of 18 racing in the teams k1 kayak single men slalomwhitewater final 20 sept 2014 start time 1547 at the 2014 'deep creek' icf or international canoe federation world championships within the adventure sports center international or asci site near deep creek lake and mchenry md usa bib number 6 hernanz samuel of spain final rank 19 out of 40 power surfing during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 6 hernanz samuel of spain final rank 19 out of 40 wave blasting during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 60 combot sebastien of france final rank 5 out of 40 power stroking through gate 12 during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 60 combot sebastien of france final rank 5 out of 40 powering through crashing waves during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 7 bercic anze of slovenia final rank 35 out of 51 power drawing through the course in single canoe men or c1 slalom whitewater during his qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 7 hradilek vavrinec of the czech republic final rank 22 out of 40 spinning downstream during his kayak single men slalom whitewater semifinal race on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 7 team czech republic jane michal and gebas vitezslav and masek jan final rank second out of eleven teams negotiating the c1 canoe single men slalomwhitewater team slalomwhitewater final 20 sept 2014 start time 1450 at the 2014 'deep creek' icf or international canoe federation world championships within the adventure sports center international or asci site near deep creek lake and mchenry md usa bib number 8 anton franz and benzien jan of germany final rank 10 out of 38 balancing through the course in tandem canoe men or c2 slalom whitewater during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 8 anton franz and benzien jan of germany final rank 10 out of 38 blasting through the course in tandem canoe men or c2 slalom whitewater during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 8 anton franz and benzien jan of germany final rank 10 out of 38 charging through the course in tandem canoe men or c2 slalom whitewater during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 8 anton franz and benzien jan of germany final rank 10 out of 38 powering through the slalom whitewater course in tandem canoe men or c2 during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 8 anton franz and benzien jan of germany final rank 10 out of 38 precariously balancing on the slalom course in tandem canoe men or c2 whitewater during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 8 anton franz and benzien jan of germany final rank 10 out of 38 precariously balancing through the course in tandem canoe men or c2 slalom whitewater during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 8 anton franz and benzien jan of germany final rank 10 out of 38 submerging through the course in tandem canoe men or c2 slalom whitewater during their qualification heat on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake bib number 9 team united states of america lefevre fabien and eichfeld casey and okken zachar negotiating the c1 canoe single men slalomwhitewater team slalomwhitewater final 20 sept 2014 start time 1450 at the 2014 'deep creek' icf or international canoe federation world championships within the adventure sports center international or asci site near deep creek lake and mchenry md usa bib number 9 team usa smolen michal and powell richard and lefevre fabien final rank 10 out of 18 racing in the k1 kayak single men teams slalomwhitewater final on 20 sept 2014 start time 1547 at the 2014 'deep creek' icf or international canoe federation world championships within the adventure sports center international or asci site near deep creek lake and mchenry md usa bicycle riders and other travelers will discover canadian rockies and lush forests and wildflowers along the icefields parkway within banff national park north of lake louise bicycle trip big bold open canoe solo whitewater canoeist charles frisk in twenty day rapids on section 3 of the wild wolf river big delta state historical park at confluence of delta river and the tanana river at big delta big smokey falls photo big thompson river to south platte river to the platte river to the missouri river to the mississippi river to the gulf of mexico atlantic ocean bill hoisington and bob obst racing their tandem whitewater open canoe at the university of wisconsin hoofers outing club sponsored last ditch whitewater slalom at gilmores mistake rapids on the wolf river during september 1989 usa wi white lake binomial name meleagris gallopavo bio photo of bob obst bio photos of bob obst bird's eye view of 492 feet high bird woman falls near goingtothesun road within glacier national park birds birthdays bishops bay country club bitter subzero cold blue skies over the university of wisconsin madison's warf or wisconsin alumni research foundation and west campus cogeneration facililty buildings usa wi madison black pool within the west thumb geyser basin of yellowstone national park black river national wild and scenic river within the ottawa national forest of michigan black river scenic byway blackwalled blanket blaze red white fireworks fourth of july celebration set the evening sky ablaze over white lake wisconsin usa wi white lake blazing autumn colors and blue skies frame the start of the second major pitch of boy scouts rapids on the wild wolf river at the gardner dam scout camp within northeastern wisconsin usa wi white lake blazing autumn colors and blue skies frame the wild wolf river at boy scouts rapids and gardner dam scout camp within northeastern wisconsin usa wi white lake blazing autumn colors frame the wild west branch of the ontonagon river north of mi highway 28 within the upper peninsula of michigan usa mi ontonagon blazing autumn colors towering over the sinks of the little river near little river road within great smoky mountains national park usa nc tn gatlinburg blazing autumn foliage blazing autumn foliage and blue skies umbrella hikers near the summit peak observation tower wihtin summit creek scenic area and porcupine mountains wilderness state park usa mi ontonagon blazing autumn foliage and blue skies umbrella hikers near the summit peak observation tower within summit peak scenic area and porcupine mountains wilderness state park usa mi ontonagon blazing autumn foliage and bright blue skies embrace the steep shores of the cascade river upstream of the mn highway 61 bridge near the lake superior hiking trail within cascade river state park usa mn lutsen blazing autumn foliage and bright blue skies frame cliff top split rock lighthouse minnesota state historic site on lake superior usa mn two harbors blazing autumn foliage embracing the little river near little river road within great smoky mountains national park usa nc tn gatlinburg blazing autumn foliage frames amnicon falls within amnicon falls state park usa wi south range blazing autumn foliage frames roaring presque isle river's manido falls within porcupine mountains wilderness state park usa mi ontonagon blazing autumn foliage frames the cascade river falls upstream of the mn highway 61 bridge along the superior hiking trail within cascade river state park usa mn lutsen blazing autumn foliage frames the wild wolf river at hollister along old military road about half way between the village of langlade and military park near lily usa wi lily blazing autumn hardwoods and granite cliffs frame lake of the clouds scenic area within porcupine mountains wilderness state park usa mi ontonagon blazing autumn hardwoods and pink granite escarpments frame lake of the clouds scenic area within porcupine mountains wilderness state park usa mi ontonagon blazing autumn hardwoods umbrella the wild wolf river along the legendary old military road at military park usa wi lily blazing autumn hardwoods umbrella the wild wolf river and witman center shelter along the legendary old military road at military park usa wi lily blazing autumn hardwoods umbrella the wild wolf river at military park usa wi lily blazing colors and gorgeous flower gardens populate the north carolina arboretum located near the blue ridge parkway during autumn usa nc asheville blazing colors of autumn within the north carolina arboretum located near the blue ridge parkway during autumn usa nc asheville blazing colors of deciduous southern forests within the north carolina arboretum located near the blue ridge parkway during autumn usa nc asheville blazing colors of forests and gardens populate the north carolina arboretum located near the blue ridge parkway during autumn usa nc asheville blazing folliage borders the byways and highways such as us highway 441 or newfound gap road within great smoky mountains national park during autumn usa nc tn gatlinburg blazing japanese maples or acer palmatum populates the north carolina arboretum located near the blue ridge parkway during autumn usa nc asheville blood red crimson sunset silhouetting wind ripped leaves during rainstorm over lake mendota park usa wi middleton blood red light floods sky over wolf river refuge woods at sunset usa wi white lake langlade blood red rainbow after sunset during rainstorm over lake mendota park usa wi middleton blood red sky at sunset blood red sunset silhouetting rain wind shaped tree during storm over lake mendota park usa wi middleton blooming butterflies event of olbrich botanical gardens within madison wisconsin usa blooming butterflies event within olbrich botanical gardens of madison wisconsin usa blooming hydrangea paniculata or angels blush panicle hydrangea within longenecker gardens of the university of wisconsin madison arboretum usa wi madison blooming lilacs or syringa vulgaris at the clear lake wayside i90 mile post 69.4 within northwestern minnesota major retirement adventure travel by robert arhtur obst tofrom usa wy cody 13 to 17 may 2015 spring into yellowstone events including selfguided tours of yellowstone national park and grand teton national park and return to usa wi middleton on 27 of may 2015 usa mn jackson blooming titan arum blue blue green lutschine river near grindelwald switzerland bern grindelwald blue hills hemlock creek segment of the ice age national scenic trail blue skies blue skies and autumn beauty reflections over rose lake near nicolet national forest road 2120 and the rose lake boat landing images from the best of environment and nature and outings near the wolf river refuge within the wolf river territory of northeastern wisconsin usa usa wi langlade blue skies and autumn beauty reflections over rose lake near the nicolet national forest road 2120 and the rose lake boat landing images from the best of environment and nature and outings near the wolf river refuge within the wolf river territory of northeastern wisconsin usa usa wi langlade blue skies and autumn colors frame boy scouts rapids on the wild wolf river near white lake usa wi white lake blue skies and autumn colors frame boy scouts rapids on the wild wolf river within northeastern wisconsin near white lake usa wi white lake blue skies and autumn colors frame boy scouts rapids upstream of the second suspension bridge on the wild wolf river within northeastern wisconsin and the gardner dam scout camp near white lake usa wi white lake blue skies and autumn colour encircle mueller lake near polar wisconsin usa wi polar blue skies and autumn reflections over mueller lake near polar wisconsin usa wi polar blue skies and blazing autumn foliage and pink granite escarpments embrace lake of the clouds within the porcupine mountains wilderness state park blue skies and blazing autumn foliage embrace lake of the clouds within porcupine mountains wilderness state park blue skies and blazing autumn foliage embrace lake of the clouds within the porcupine mountains wilderness state park if one likes obst fav photos 2013 nikon d300s destinations wild scenic image 6247 one can buy it with professional printing or share it and others like it here blue skies and blazing autumn foliage embrace lake of the clouds within the porcupine mountains wilderness state park if one likes obst fav photos 2013 nikon d300s landscapes inspirational image 6255 one can buy it with professional printing or share it and others like it here blue skies and blazing autumn hardwoods and granite escarpments encircle lake of the clouds scenic area within porcupine mountains wilderness state park usa mi ontonagon blue skies and blazing autumn hardwoods and granite escarpments surround lake of the clouds scenic area within porcupine mountains wilderness state park usa mi ontonagon blue skies and blazing folliage and fresh snowfall frames us highway 441 or newfound gap road within great smoky mountains national park during autumn usa nc tn gatlinburg blue skies and boreal forests embrace the dark limestone gorges of the maligne river canyon within jasper national park canada alberta jasper blue skies and brilliant autumn colors greet visitors near the parking lot within indian lake county park usa wi cross plains blue skies and cliffs and mountains as viewed from goingtothesun road near logan pass within glacier national park usa mt west glacier blue skies and colorful autumn trees and turquoise waters highlight the southeastern shores of devils lake within devils lake state park usa wi baraboo blue skies and cotton candy clouds over margerie glacier and tarr inlet and mount forde within glacier bay national park and preserve blue skies and cotton candy clouds over margerie glacier and tarr inlet and mount forde within glacier bay national park and preserve usa ak gustavus blue skies and cotton candy clouds over margerie glacier and tarr inlet near mount forde within glacier bay national park and preserve usa ak gustavus blue skies and dark mountains frame the saskatchewan glacier near the icefield's parkway within banff national park blue skies and deep snow over the temperance river gorge within temperance river state park on the north shore of lake superior blue skies and fog over kachemak bay near the sterling highway by homer on the western kenai peninsula of alaska usa alaska homer blue skies and granite escarpments frame devil's lake and a climber on a gorgeous spring day within devil's lake state park blue skies and green slopes and towering moutains encircle mendenhall glacier within tongass national forest usa alaska juneau blue skies and green slopes and towering moutains guard mendenhall glacier within tongass national forest blue skies and radiant autumn foliage frame the bad river above copper falls within copper falls state park blue skies and radiant autumn foliage frame the cascades of the tyler forks river above brownstone falls within copper falls state park blue skies and radiant autumn foliage frame the tumbling tyler forks river above brownstone falls within copper falls state park blue skies and resplendent autumn colors encircle a fisherman on indian lake within indian lake county park usa wi cross plains blue skies and resplendent autumn colors encircle a fisherman on indian lake within indian lake county park usa wi cross plains rao 2012 nikon d300s image 3576 blue skies and resplendent autumn colors encircle fisherman on indian lake within indian lake county park usa wi cross plains blue skies and snowy mountains and topeka glacier tower over a turquoise john hopkins inlet within glacier bay national park and preserve usa ak gustavus blue skies and turquoise water frames rafters' can toss on the unkar creek delta at mile seventytwo 72 of the colorado river within grand canyon national park usa az grand canyon blue skies and turquoise waters frame monona terrace community and convention center along lake monona usa wi madison blue skies and waterfalls and snowy mountains encircle avalanche lake near the avalanche creek trailhead east of goingtothesun road within glacier national park blue skies and white clouds and green slopes and towering moutains guard mendenhall glacier within tongass national forest blue skies over a frozen pier within the ice and snow covered breakwaters of lake superior at grand marais blue skies over a lunar like volcanic landscape along north crater flow trail within craters of the moon national monument blue skies over a national forest service motorboat approaching holland america zaandam cruise ship on sitakaday narrows of glacier bay within glacier bay national park and preserve usa ak gustavus blue skies over ancient roque gageac on the beautiful and serene dordogne river blue skies over and blazing autumn colors along ice age national scenic and balanced rock trails within southeastern devils lake state park usa wi baraboo blue skies over blazing golden hardwoods forest by the east bluff trail of devils lake state park usa wi baraboo blue skies over cedar rapids at 1110 cfs on the last day of winter 2012 within section 2 of the wild wolf river usa wi white lake blue skies over colorful escarpments and mountains near mt. athabasca and the saskatchewan glacier within banff national park blue skies over deep dark limestone gorge of the maligne river canyon within jasper national park canada alberta jasper blue skies over flowers ponds rocks in allen centennial gardens of the university of wisconsin madison usa wi madison blue skies over hikers on highline trail near logan pass within glacier national park usa mt west glacier blue skies over lake superior blue skies over margerie glacier and tarr inlet and mount forde within glacier bay national park and preserve usa ak gustavus blue skies over margerie glacier near mount forde and the seashores of tarr inlet within glacier bay and glacier bay national park and preserve blue skies over mount rushmore national memorial blue skies over sparkling cedar rapids at high water flow or 1110 cfs on the last day of winter 2012 within section 2 of the wild wolf river blue skies over unkar creek delta indian ruins at mile seventytwo 72 of the colorado river within grand canyon national park usa az grand canyon blue skies turquoise water and gorgeous rapids please kayakers within class 3 to 4 south fork of the payette river canyon blue skies umbrella a youth canoeist fishing off an island on breeze dappled mijinemungshing lake within lake superior provencial park canada ontario wawa blue skies view towards mount turner over the john hopkins inlet of glacier bay national park and preserve usa ak gustavus blue sky aerial view of mendenhall wetlands state game refuge and the outlet of the mendenhall river into fritz cove and auke bay of the pacific ocean usa alaska juneau blue sky aerial view of snow and ice covered mountains stretching to horizon at the heart of the juneau icefield within the tongass national forest usa alaska juneau blue sky views of a dramatic granite peak encircled by the juneau icefield within tongass national forest usa alaska juneau blue sky views of amherst peak encircled by the juneau icefield and mendenhall glacier within tongass national forest usa alaska juneau blue sky views of mount merriam and its foothills from glacier bay within glacier bay national park and preserve usa ak gustavus blue sky views of the juneau icefield and amherst peak and mendenhall glacier within tongass national forest usa alaska juneau blue sparkling waters and lovely sea shores within the tongass narrows of the pacific ocean after it departs ketchikan alaska usa alaska ketchikan blue star creeper isotoma fluviatilis campanulaceae native of australia and new zealand blueskiesautumnreflections bluff bnp boat house and canoeists on mountain and glacier guarded maligne lake within jasper national park canada alberta jasper boat scouting crystal rapids from eddy at mile ninetyeight 98 of the colorado river within grand canyon national park usa az grand canyon boaters enjoying spectacular fireworks over white lake during the fourth of july celebration usa wi white lake boaters view of bald eagles or haliaeetus leucocephalus proudly guarding a channel marker within lynn channel between admiralty island and auke bay in the pacific ocean north of juneau usa alaska juneau bob obst bicycling past historic monument église notredame de l'assomption d'aillac at carsacaillac within the dordogne river valley europe france limousin périgord dordogne river valley carsacaillac bob obst daily favorite photos bob obst family madison and middleton area favorite outings arboretum of the university of wisconsin madison bob obst family madison middleton area favorite outings arboretum of the university of wisconsin madison bob obst favorite or best photos bob obst favorite photo favorites 2012 bob obst favorite photos bob obst favorite photos 2012 bob obst favorite photos 2013 bob obst favorite photos iceland bob obst images of the north carolina arboretum usa nc asheville bob obst images sharegroup canoekayakwhitewaterracingo at htt bob obst images sharegroup canoekayakwhitewaterracingo at httpwww.robertarthurobstphotos.comshareucsda727pe6fg bob obst in his fiberglass slalom kayak wwith a norse flat bladed paddle and a faceful of foam in the main plunge of challenging dave's falls on the pike river at high flows during the spring of 1973 usa wi amberg bob obst kayaking past les plus beaux villages de france la roque gageac highlighted by gorgous evening light within the dordogne river valley europe france limousin périgord dordogne river valley la roque gageac bob obst nordic skiing through deep powder snow in the rugged valley of the amnicon river within amnicon falls state park bob obst photo collage of images 2602 and 2603 and 2604 and 2605 and 2606 bob obst photo collage of images 2674 and 2675 and 2676 bob obst photo collage of images 2864 and 2884 and 2879 bob obst photo favorites bob obst photo favorites 2012 bob obst photo favorites 2013 bob obst photos 2010 bob obst photos 2012 bob obst photos best 1987 bob obst photos best 2008 bob obst photos best 2010 bob obst photos best 2011 bob obst photos collage of images 1484 and 1485 and 1496 and 1498 and 1502 bobst.wrr.ben_0054_neotb.honeybeescommonthistlebywolfriverwithinwolfriverrefugeb bobst_8757_ak07sewardaktoanchoragedenaliparkak.gorgeoussewardsmallboatharborb boiling blue clouds over sun rippled riffles and canoeists on the wild scenic wolf river usa wi white lake boiling rapids fill bad river gorge of black lava at copper falls state park boiling rapids in bad river gorge of black lava at copper falls state park boiling rapids in bad river gorge of black lava from north country national scenic trail in copper falls state park usa wi mellen boiling wildwater engulfs open canoe during high flows in hansen's rapids on the wild wolf river usa wi white lake boise national forest bold blue skies over icicles which are embracing a sandstone cliff and caves within apostle islands national lakeshore on lake superior bold hungry acrobatic skippy the squirrel eats our lunch at our rabbit blanket lake camp bold hungry acrobatic squirrel we called skippy steals our lunch at our rabbit blanket lake camp bold hungry agile squirrel makes this skippy peanut butter jar famous boreal forest autumn reflections at the mouth of the presque isle river by lake superior within porcupine mountains wilderness state park and presque isle river scenic area usa mi ontonagon boreal forest canyon boundary ranges of the coast mountains boundary ranges of the coast mountains alaska usa boundary ranges of the coast mountains mount cooper alaska usa boundary ranges of the coast mountains sawtooth range alaska usa boundary ranges of the coast mountains tower over humpback whale tail and whale spouts near funter bay state marine park within lynn canal between admiralty island and auke bay in the pacific ocean boundary ranges of the coast mountains tower over humpback whale tail near funter bay state marine park within lynn canal between admiralty island and auke bay in the pacific ocean usa alaska juneau boundary ranges of the coast mountains towering over humpback whales tail within lynn canal east of north admiralty island in the pacific ocean usa alaska juneau bow canoeist's view of sherry rapids on sectopm 2 of the wild wolf river of wisconsin usa bow canoeists's view of sherry rapids sparkling in the mid day sun on section 2 of the wild wolf river usa wi white lake langlade bow paddler hang time concentration and chaos and a little air time for a tandem open canoe couples team blasting through lower sherry rapids during the 2014 wolfman triathlon at 912 cubic feet per second or 8.91 ft on the langlade usgs gauge on section 2 of the wild wolf river bow river to south saskatchewan river to saskatchewan river to lake winnipeg to nelson river to hudson bay of the atlantic ocean bowman lake boy scout rapids boy scouts of america baylakes council gardner dam scout camp boy scouts or hikers or paddlers enjoy blue skies and autumn colors along boy scouts rapids on the wild wolf river within northeastern wisconsin and the gardner dam scout camp near white lake braided glacier and colorful mountains southeast of regal mountain within wrangell st. elias national park and preserve usa alaska mccarthy branch brandenburger ache inn danube austria or österreich watershed brandenburger ache river austria brandenburger ache river tyrol alpbachtal austria or österreich brave kids para gliding over beautiful south padre island and south bay of the gulf of mexico breaking nine foot body surfing wave of poseidons rage in mt. olympus water theme park usa wi wisconsin dells breathtaking blazing crimson red sunset over the wolf river refuge from the wolf river refuge access road within northeastern wisconsin usa wi white lake breathtaking blazing crimson red sunset over the wolf river wisconsin usa breathtaking reflections over canoe on the wild wolf river section 4 within menominee indian nation between otter slide and sullivan falls usa wi keshena breathtaking view of banff and the bow river valley from the top of sulphur mountain near the banff gondola skywalk and cosmic ray station national historic site of canada canada ab banff breathtaking view of stanley park and downtown vancouver from the top of the harbour centre tower can bc vancouver bridgerteton national forest and the valley of the upper grey bridgerteton national forest and the valley of the upper greys river watershed near alpine wyoming major retirement adventure travel by robert arhtur obst tofrom usa wy 13 to 27 of may 2015 spring into yellowstone events including selfguided tours of yellowstone national park and grand teton national park areas and return to usa wi middleton usa wy alpine bridgerteton national forest service cabin within the valley of the upper greys river watershed near alpine wyoming major retirement adventure travel by robert arhtur obst tofrom usa wy 13 to 27 of may 2015 spring into yellowstone events including selfguided tours of yellowstone national park and grand teton national park areas and return to usa wi middleton usa wy alpine brilliant orange sunrise over a misty lake mendota and the state capitol of madison wisconsin from pheasant branch conservany usa wi middleton brilliant orange sunrise over lake mendota and the state capitol of madison wisconsin usa wi middleton brilliant south dakota badlands bursting with colors after rain brilliant south dakota badlands bursting with colors after rain usa south dakota wall brilliant sun brilliantautumncolorswithinindianlakecountypark brilliantly turquoise kootenay river at vermilion crossing within kootenay national park canada bc radium hot springs british bronze medalists in canoe double or c2 men team czech republic karlovsky ondrejjane jakub and kaspar jonassindler marek and koplik tomasvrzan jakub final rank 3rd out of 11 c2 teams final runs on 21 sept 2014 at the 2014 'deep creek' world championships at the adventure sports center international site near deep creek lake and mchenry md usa bronze medalists in canoe double or c2 men team czech republic karlovsky ondrejjane jakub and kaspar jonassindler marek and koplik tomasvrzan jakub final rank 3rd out of 11 c2 teams final runs on 21 sept 2014 at the 2014 'deep creek' world championships at the adventure sports center international site near deep creek lake and mchenry md usa usa md mchenry bronze medalists kayak single women or k1w team of slovakia kaliska elena and dukatova jana and nevarilova kristina final runs final rank 3rd out of 13 k1w teams on 21 sept 2014 at the 2014 icf 'deep creek 'world championships at the adventure sports center international site near deep creek lake and mchenry md usa bronze medalists kayak single women or k1w team of slovakia kaliska elena and dukatova jana and nevarilova kristina final runs final rank 3rd out of 13 k1w teams on 21 sept 2014 at the 2014 icf 'deep creek 'world championships at the adventure sports center international site near deep creek lake and mchenry md usa usa md mchenry brook tumbles towards mount cannon and bearhat mountain near hidden lake overlook trail within glacier national park brown bear or ursus arctos of the kingdom animalia and phylum chordata and class mammalia and order carnivora and family ursidae and genus ursus and species ursus arctos bst fav photos nikon d800 daily best obst image 8101 bst fav photos nikon d800 landscapes inspirational image 6632 bst fav photos nikon d800 landscapes inspirational image 8274 bst fav photos nikon d800 landscapes inspirational obst image 8092 bst fav photos nikon d800 sports fun extraordinaire image 8472 bstbest2008_usa wi mmo_02131 b2_baraboo devilslsp colorsu bubble net feeding buffalo on road with autos bull elk grazing near grand loop road and gibbons meadows in yellowstone national park bull elk near big thompson river in beaver meadows of rocky mountain national park usa co estes park bus busy honey bee of the genus apis on flowers by the wolf river refuge within the wolf river territory but but whose fragrance makes the garden a place of delight just the same. helen keller hummingbird moth in flower garden by the wild wolf river within the wolf river refuge butterfly giant swallowtail papilio cresphontes eastern usa to arizona butterfly monarch danaus plexippus north america butterfly monarch wisconsin danaus plexippus most of north america buy by imagery creation evangelist robert arthur obst r.obstatt.n by imagery creation evangelist robert obst or bob obst images a by imagery creation evangelist robert obst or bob obst images and photography and capturing memories by imagery creation evangelist robert obst or bob obst images and photography and capturing memories at by imagery creation evangelist robert obst or bob obst images and photography and capturing memories at © robert arthur obst c01 c1 c1 canoe single men slalomwhitewater final runs on 20 sept 2014 start time 1202 at the 2014 'deep creek' world championships within the adventure sports center international or asci site near deep creek lake and mchenry md usa c1 master 15 rac bib no 163 clayton cole of shirley ma usa action at the 2016 aca open canoe usa slalom nationals na championships 22 24 july 2016 usa wi wausau c1 open 13 rac bib no 107 john kazimierczyk of richmond nh usa c1 open 13 rac bib no 107 john kazimierczyk of richmond nh usa action at the 2016 aca open canoe usa slalom nationals na championships 22 24 july 2016 usa wi wausau c1 open x rac bib no 165 dewey ewers of langlade wi usa action c1 open x rac bib no 165 dewey ewers of langlade wi usa action at the 2016 aca open canoe usa slalom nationals na championships 22 24 july 2016 usa wi wausau c1 paddler bob obst in kimball falls on the west branch of the montreal river c1 women rac bib no 124 gabriella schlidt of atlanta ga usa action at the 2016 aca open canoe usa slalom nationals na championships 22 24 july 2016 usa wi wausau c1 women rac bib no 128 ileana areiza of alberton mt us actio c1 women rac bib no 128 ileana areiza of alberton mt us action at the 2016 aca open canoe usa slalom nationals na championships 22 24 july 2016 usa wi wausau c1menteams c1u23 c1w canoe single women slalomwhitewater final 20 sept 2014 start time 1232 at the 2014 'deep creek' icf or international canoe federation world championships within the adventure sports center international or asci site near deep creek lake and mchenry md usa c2 open rec bib no 152 amy vickers and pete steffes of elcho wi c2 open rec bib no 152 amy vickers and pete steffes of elcho wi usa action at the 2016 aca open canoe usa slalom nationals na championships 22 24 july 2016 usa wi wausau c2 paddlers ray mclain and don sorensen engaging the crux of rock cut falls or railroad rapids on the west branch of the montreal rive c2 paddlers steve drobnick and bob schuetzler just downstream of the crux of rock cut falls or railroad rapids on the west branch of the montreal rive c2m c3 cactus along the colorful tapeats creek canyon of the colorado river within grand canyon national park usa az grand canyon camp camp anokijig week eight anokijig spirit first place photo contest winner elysia obst camp nine 9 near deer creek falls at mile one hundred thirty six 136 along the colorado river within grand canyon national park usa az grand canyon camp ten 10 near matkatamiba canyon at mile one hundred forty eight 148 along the colorado river within grand canyon national park usa az grand canyon camp two tiger wash at mile twentysix of the colorado river within grand canyon national park usa az grand canyon camp2 campers and canoeists and hikers will enjoy gorgeous views of the north fork of the chena river between red squirrel campground and chena hot springs within the chena river state recreation area northeast of fairbanks usa alaska chena hot springs can can ab lake louise can alberta jasper can alberta jasper beauty creek wilderness youth hostel can alberta saskatchewan river crossing can bc inland passage vancouver can british columbia field emerald lake can you identify this kayaker canada canada alberta banff canada alberta banff and banff gondola to sulphur mountain canada alberta banff and sunshine village and sunshine meadows canada alberta banff fairmont banff springs hotel canada alberta banff johnston canyon canada alberta banff national park canada alberta banff national park banff gondola sulphur mountain 7486 feet or 2281 meters canada alberta banff national park banff sulphur mountain canada alberta banff national park bow river valley canada alberta banff national park icefields parkway big bend saskatchewan river crossing canada alberta banff national park lake louise canada alberta banff national park mistaya river canyon canada alberta banff national park mistaya river canyon saskatchewan crossing canada alberta banff national park mistaya river valley canada alberta banff national park moraine lake canada alberta banff national park waterfowl lakes canada alberta banff sulphur mountain gondola canada alberta banff sulphur mountain gondola skywalk and cosmic ray station national historic site of canada canada alberta jasper canada alberta jasper beauty creek wilderness youth hostel canada alberta jasper national park canada alberta jasper national park athabasca river valley canada alberta jasper national park athabasca river valley honeymoon lake canada alberta jasper national park jasper canada alberta jasper national park maligne lake canada alberta jasper national park maligne river canyon canada alberta jasper national park maligne river valley canada alberta jasper national park mt edith cavell canada alberta jasper national park sunwapta pass columbia icefield canada alberta jasper national park sunwapta river valley canada alberta jasper national park sunwapta river valley beauty creek canada alberta lake louise canada alberta saskatchewan river crossing canada bc fraser canada british columbia field canada british columbia kootenay national park canada kootenay national park radium hot springs british columbia kootenay river vermilion crossing canada kootenay national park radium hot springs british columbia marble canyon tokumm creek canada kootenay national park radium hot springs british columbia mitchell mountains canada ontario canada ontario canoeing canada ontario hattie cove canada ontario heron bay pukaskwa national park canada ontario matawaska river canada ontario on heron bay canada yoho national park canada british columbia field canada yoho national park canada british columbia field monarch campground canadian rocky mountain parks world heritage site canado ontario lake superior provencial park canary or canaries native to canary islands canoe canoe and kayak whitewater friends raftup on the colorado river within grand canyon national park usa az grand canyon canoe double men or c2 and kayak single women or k1w individual semifinal runs on 21 sept 2014 at the 2014 icf 'deep creek 'world championships at the adventure sports center international site near deep creek lake and mchenry md usa canoe double men or c2 and kayak single women or k1w team and individual final runs on 21 sept 2014 at the 2014 icf 'deep creek 'world championships at the adventure sports center international site near deep creek lake and mchenry md usa canoe double or c2 men individual gold medalist and world champions bozic luka and taljat saso of slovenia final rank 1st out of 38 competitors during their final run on 21 sept 2014 at the 2014 icf 'deep creek 'world championships at the adventure sports center international site near deep creek lake and mchenry md usa canoe double or c2 men individual gold medalist and world champions bozic luka and taljat saso of slovenia final rank 1st out of 38 competitors during their final run on 21 sept 2014 at the 2014 icf 'deep creek 'world championships at the adventure sports center international site near deep creek lake and mchenry md usa usa md mchenry canoe double or c2 men individual hurd eric and larimer jeff of the usa final rank 32 out of 38 c2 teams qualification run on 19 sept 2014 at the 2014 'deep creek' world canoe double or c2 men individual hurd eric and larimer jeff of the usa final rank 32 out of 38 c2 teams qualification run on 19 sept 2014 at the 2014 'deep creek' world championships at the adventure sports center international site near deep creek lake and mchenry md usa canoe double or c2 men individual hurd eric and larimer jeff of the usa final rank 32 out of 38 c2 teams qualification run on 19 sept 2014 at the 2014 'deep creek' world championships at the adventure sports center international site near deep creek lake and mchenry md usa usa md mchenry canoe double or c2 men individual hurd eric and larimer jeff of the usa final rank 32 out of 38 c2 teams qualification run on 21 sept 2014 at the 2014 'deep creek' world championships at the adventure sports center international site near deep creek lake and mchenry md usa canoe double or c2 men individual mccleskey scott and fraker benn of the usa final rank 35 out of 38 c2 teams qualification run on 19 sept 2014 at the 2014 'deep creek' world championships at the adventure sports center international site near deep creek lake and mchenry md usa canoe double or c2 men individual mcewan devin and eichfeld casey of the usa final rank 15th out of 38 c2 teams semifinal runs on 21 sept 2014 at the 2014 'deep creek' world championships at the adventure sports center international site near deep creek lake and mchenry md usa canoe double or c2 men individual mcewan devin and eichfeld casey of the usa final rank 15th out of 38 c2 teams semifinal runs on 21 sept 2014 at the 2014 'deep creek' world championships at the adventure sports center international site near deep creek lake and mchenry md usa usa md mchenry canoe double or tandem men or c2 slalom whitewater qualification heat first and second runs on 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake and mchenry md usa canoe kayak raft competition canoe kayak whitewater racing canoe menominee county canoe on emerald lake guarded by the president mountain range and top hat peak near field within yoho national park can bc field canoe on emerald lake southeast of top hat peak near field within yoho national park can bc field canoe sailing under gorgeous blue skies in front of the university of wisconsin madison's memorial union terrace on lake mendota usa wi madison canoe slalom whitewater canoe solo men team juniors zachary lokken and jordan poffenberger and andre sanborn of the usa negotiating gates 8 through 10 during the finals of the 2012 icf canoe slalom junior and u23 world championships usa wi wausau canoe solo men team juniors zachary lokken and jordan poffenberger and andre sanborn of the usa negotiating gates 9 through 12 during the finals of the 2012 icf canoe slalom junior and u23 world championships usa wi wausau canoe wisconsin canoe wisconsin whitewater canoe wisconsin whitewater competition canoeing canoeing the deadman's bar to moose section of the snake river within grand teton national park canoeing the wolf river canoeist canoeist charlie frisk approached the crux drops of the dalles of the wolf at a river flow of 744 cfs on the wild wolf river section 4 within menominee indian nation usa wi keshena canoeist charlie frisk teaching moment canoeist's and floater's view of the gorgeous grand teton mountains on the deadman's bar to moose section of the snake river within grand teton national park canoeist's and floater's view on the deadman's bar to moose section of the snake river within grand teton national park canoeist's gorgeous view of autumn colors framing section 2 of the wild scenic upper wolf river above the last pitch of nine mile rapids canoeist's gorgeous view of blue skies and autumn colors over section 2 of the wild scenic upper wolf river at the wolf river refuge canoeist's view of an orange sunset over lake superior's old woman bay within lake superior provencial park canoeist's view of autumn magic reflections at sunset over mueller lake within northeastern wisconsin near polar canoeist's view of boreal forest autumn reflections at the mouth of the presque isle river by lake superior within porcupine mountains wilderness state park and presque isle river scenic area canoeist's view of glaciated peaks encircling crystalline serene colorful bowman lake within glacier national park canoeists and hikers and other adventurers enjoy gorgeous views of the north fork of the chena river between red squirrel campground and chena hot springs within the chena river state recreation area canoeists explore the turquoise waters of mountain guarded maligne lake within jasper national park canada alberta jasper canoeists on lake louise with fairmont chateau lake louise and the lake louise downhill skiing area in the background within unesco world heritage site banff national park canoeists view of glaciated peaks encircling crystalline serene colorful bowman lake within glacier national park usa mt polebridge canoeists view of pelicans flying over the salt river near alpine wyoming major retirement adventure travel by robert arhtur obst tofrom usa wy 13 to 27 of may 2015 spring into yellowstone events including selfguided tours of yellowstone national park and grand teton national park areas and return to usa wi middleton usa wy alpine canoeists view of pelicans on the salt river near alpine wyoming major retirement adventure travel by robert arhtur obst tofrom usa wy 13 to 27 of may 2015 spring into yellowstone events including selfguided tours of yellowstone national park and grand teton national park areas and return to usa wi middleton usa wy alpine canoeists view of snowy mountains framing pelicans on the salt river near alpine wyoming major retirement adventure travel by robert arhtur obst tofrom usa wy 13 to 27 of may 2015 spring into yellowstone events including selfguided tours of yellowstone national park and grand teton national park areas and return to usa wi middleton usa wy alpine canoeists' view of flowery fields and mountains along the salt river valley near alpine wyoming major retirement adventure travel by robert arhtur obst tofrom usa wy 13 to 27 of may 2015 spring into yellowstone events including selfguided tours of yellowstone national park and grand teton national park areas and return to usa wi middleton usa wy alpine canoeists' view of trumpeter swams flying over the salt river near alpine wyoming major retirement adventure travel by robert arhtur obst tofrom usa wy 13 to 27 of may 2015 spring into yellowstone events including selfguided tours of yellowstone national park and grand teton national park areas and return to usa wi middleton usa wy alpine canoekayakwhitewaterracingo canoekayakwhitewaterracingo and riverfriendo sharegroups by bob obst canoekayakwhitewaterracingo sharegroup by bob obst canyon canyon creek to mckenzie creek to clam river to st. croix river to mississippi river to gulf of mexico and the atlantic ocean canyon grotto view from a canoe at mile thirtyfive 35 of the colorado river within grand canyon national park usa az grand canyon canyoncontrasts capitol capsized canoeist swimming crystal rapids at mile ninetyeight 98 of the colorado river within grand canyon national park usa az grand canyon caption caption ' 1 august 2015 walkerexplorers view of the amazing all glass and steel 'harpa concert hall and conference center' situated along the colorful and historic ocean front of downtown reykjavik iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland reykjavik caption ' 3 august 2015 arthur robert obst's rainy day view of the gorgeous volcanic rift valley within pingvellir national park and western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 iceland pingvellir caption full supermoon sunrise begins at 639 pm over the pheasant branch creek conservany and the lake mendota waterfront near captain bills restaurant within middleton wi usa fav or favorite obst family outings within southern wisconsin usa usa wi madison middleton captions carnal knowledge of a julia butterfly or dryas iulia also known as julia heliconian or the flame or or flambeau within olbrich botanical gardens during 18 july to 12 august 2012 blooming butterflies usa wi madison carnal knowledge or mating ritual of a julia butterfly carp river to lake superior to st. marys river to lake huron to st. clair river to lake st. clair to detroit river to lake erie to niagara river to lake ontario to st. lawrence river to atlantic ocean carp river to lake superior to st. marys river to lake huron to st. clair river to lake st. clair to the detroit river to lake erie to niagara river to lake ontario to st. lawrence river to the atlantic ocean cascade on mcdonald creek along goingtothesun road upstream of mcdonald lake within glacier national park cascade river state park cascade river state park recreation site cascading avalanche of china snow pekin lilac flowers in longenecker gardens of the university of wi madison arboretum usa wi madison cascading waterfalls castle geyser in the upper geyser basin near the firehole river cataraft engaging staircase rapids on the alder creek bridge near garden valley idaho to staircase rapids section of the south fork of the payette river near loman idaho cats or felis catus in love necking in my closet autumn breeze obst and winter frost obst usa wi middleton ccs ccskiersviewpmsunoveroaksbirchwood celebrating fourth of july 2013 celebrating fourth of july 2013 independence day in the usa fireworks over white lake wisconsin within the wolf river territory celebrating freedom celebrating freedom and its defenders celebrating new year 2011 in style with memories of rhythm and booms fireworks celebrating the fourth of july 2013 or independence day in the usa with fireworks over white lake wisconsin within the wolf river territory usa wi white lake cerulean autumn skies and blazing orange maple trees frame saint williams catholic church within northeastern wisconsin usa wi eland cerulean skies and evening mountain light over canoes and turquoise moraine lake within banff national park canada ab lake louise cerulean skies and vibrant colors frame smoking castle geyser within yellowstone national park usa wy ynp cerulean skies and violet flowers profile chief kyan totem pole in whale park within downtown ketchikan usa alaska ketchikan cerulean skies embrace the juneau icefield and its snowy mountain peaks and snowfields within the tongass national forest usa alaska juneau cerulean skies frame an impressive statue of robert e. lee atop the virginia memorial at gettysburg national military park cerulean skies frame gorgeous canyon views at mile fifty nine 59 of the colorado river within grand canyon national park cerulean skies frame the juneau icefield and its snowey mountains such as amherst peak within the tongass national forest usa alaska juneau cerulean skies frame the juneau icefield and its snowy mountains such as amherst peak within the tongass national forest cerulean skies over canoes and mountains and turquoise moraine lake within banff national park cerulean skies over canoes and turquoise moraine lake within banff national park canada ab lake louise cerulean skies over radiant red built in 1894 armory old red gym of the university of wisconsin madison usa wi cerulean skies over snow capped maroon bells near crater lake during early summer usa co aspen cerulean skies over the many glacier boat dock on swiftcurrent lake and mt. henkel within glacier national park usa mt west glacier champlain shrub rose canadian explorer series rosaceae rose kordesie charlie frisk cliff jumping just downstream of the dalles on se charlie frisk cliff jumping just downstream of the dalles on section 4 of the wild wolf river between otter slide and big smoky falls within the menominee indian nation of wisconsin usa wi keshena chena river state recreation area chena river state recreation area northeast of fairbanks usa alaska chena hot springs chief kyan totem pole whale park ketchikan alaska usa child perched on rock studies marmot by hidden lake overlook trail within glacier national park china snow pekin lilac tree syringa pekinensis chipmunk or tamias begging for food from hikers on the shores of avalanche lake near the avalanche creek trail east of goingtothesun road within glacier national park chipmunk scientific classification kingdom animalia phylum chordata class mammalia order rodentia suborder sciuromorpha family sciuridae tribe marmotini subtrib tamiina genus tamias or chipmunk chocolate chocolate outflow running chuckles floribunda rose in olbrich botanical gardens usa wi madison chuckles floribunda rose or rosa chuckles or rosaceae cultivated chugach national forest chugach national forest of alaska church clock tower within the gail river valley of tyrol austria europe austria tyrol lienz obertilliach gail river valley class class 2 birds of prey swan falls dam to walters ferry section of the snake river class 2 to 4 alder creek bridge near garden valley idaho to staircase rapids section of the south fork of the payette river class 2 to 4 lowman to pine flats idaho section of the south fork of the payette river class 2 to 4 mountain view campground upriver of lowman to pine flats campground idaho section of the south fork of the payette river class 3 to 4 grandjean to lowman idaho section of the south fork of the payette river class 3 to 4 grandjean to pine flats near loman idaho section of the south fork of the payette river class 3 to 4 rapids class 34 bad river gorge about twothirds mile below twenty nine foot copper falls at high flows class 4 rapidsfilled lower deadwood river canyon class 4 to 5 wilderness high water over 6 feet on krassel ranger station gauge class i class iii to iv class iv rapids class iv to v kayaking class ivv kayaking class one clear blue skies clear blue skies over open canoes on gorgeous turquoise emerald lake within yoho national park near field british columbia canada clear blue skies over the university of cincinnati's nippert stadium and historic university of cincinnati campus usa oh cincinnati clearwing moth or hummingbird moth in flower garden by the wild wolf river within the wolf river refuge clearwing moth or hummingbird moth of the kingdom animali and phylum arthropoda class insecta and order lepidoptera and family sphingidae and genus hemaris by dalman 1816 cleopatra liliaceae eremerus x native to west and central asia cliff cliffs cliffwalled climate change close up of moonset over the wolf river refuge and the wild wolf river usa wi langlade close up of sparkling water droplets clinging to the first colorful blooming iris a greek word for 'rainbow' during springtime at the wolf river refuge usa wi white lake close up of water droplets clinging to the first colorful blooming iris a greek word for rainblow during springtime at the wolf river refuge usa wi white lake close up of water droplets clinging to the first colorful blooming iris or a greek word for rainblow during springtime at the wolf river refuge usa wi white lake closeup of bob obst's open canoeing sweet route over big smokey falls at 744 cfs on the wild wolf river section 4 within menominee indian nation or menominee county usa wi keshena closeup of exploding whitewater encircling open canoeist charlile frisk as he approaches the final drop of big smokey falls at 744 cfs on section 4 of the wild wolf river within menominee indian nation or menominee county usa wi keshena closeup of wasps within the vegetable gardens of outside olbrich botanical gardens usa wi madison closeup of whitewater open canoeist charlile frisk blasting thourgh a breaking wavehole as he approaches the final drop of big smokey falls at 744 cfs on section 4 of the wild wolf river within menominee indian nation or menominee county usa wi keshena closeup open canoeist flying through the whitewater turbulence of the final drop of big smokey falls at 744 cfs on the wild wolf river section 4 within menominee indian nation usa wi keshena closeup photo of a black bettle on a red flower at sunset within longenecker gardens of the university of wisconsin madison arboretum usa wi madison closeup photo of a wild turkey within longenecker gardens of the university of wisconsin madison arboretum usa wi madison clouds and skies reflected in grizzly lake near the garden path trail in the sunshine meadows area of alberta and british columbia within banff national park and the canadian rocky mountains clouds and turbulent wash behind the holland america zaandam ship while cruising the inside passage north of vancouver canada can bc inside passage vancouver clouds enshroud snowy mountains over sun drenched blue green icy lutschine river near grindelwald switzerland bern grindelwald clouds enshrouded snowy mountains dwarf a kayaker onthe icy clown garbo canoe bow near the unkar creek delta at mile seventytwo 72 of the colorado river within grand canyon national park usa az grand canyon coast mountains and amherst peak tower over juneau icefield within tongass national forest usa alaska juneau coastal kayakers exploring the kachemak bay state critical habit coastal kayakers exploring the kachemak bay state critical habitat area near homer alaska exploring the sounds and inland passages of alaska to views of whales and dolphins and eagles within the gulf of alaska of the pacific ocean between ketchikan and homer alaska during july of 2011 usa ak homer cody country of wyoming chamber of commerce spring into yellowst cody country of wyoming chamber of commerce spring into yellowstone birding and wildlife festival collage collage of 3 pictures of red foxes dsc_9194bc and dsc_9072bc and dsc_9086bc captured along denali park road collage of daily best or fav images by bob obst or robert obst collage of dall sheep images dsc_0361 and dsc_0374 and dsc_035906.07.2012 collage of images 2196 and 2197 and 2199 collage of images 2262 and 2263 and 2265 and 2268 and 2273 . collage of images dsc_6716 and dsc_6695 and dsc_6719 and dsc_6747 and dsc_6717 and dsc_6738 collage of images of devil's lake state park on a gorgeous spring day collage of images of hikers and their companions discovering gorgeous views and wild birds and petroglyphs and wiild apricot trees and swimming holes and desert creatures within the morley nelson snake river birds of prey national conservation area near murphy idaho collage of obst fav photos 2015 nikon d800 daily best obst image 142814101418142814291453146214801488 collage of photos 2436 and 2437 and 2438 and 2439 and 2440 collage of photos of wicklife w. or wick walker canoeing the linville river wiithin the linville gorge wilderness area of north carolina usa collage of solo canoe men under 23 patrik gajarsky of slovakia recovering after backendering his canoe upon approach to gate 10 during the finals of the 2012 icf canoe slalom junior and u23 world championships usa wi wausau collage of three photos collage of three photos of autumn hardwoods over wolf river and the witman center shelter and state of wisconsin old military road historical marker along state highway 55 collage or combined images in photoshop of american ealges over kachemak bay near homer within the kenai peninsula of alaska collageallwinners collagehr collageimagesonlyhr collagetextcr collagetitletext collagewithimagetitle collagewithnotext collagewithnotextnocr collagewithtext collagewithtitle collagewithtitleonly collagewlabel collagewnocrortitle collagewtextcr01 collagwithtitleonly college fjord was the epicenter of the good friday earthquake of 1964 the most powerful earthquake in usa history colorado river gorge colorado river gorge at dead horse point colorado river gorge view from dead horse point towards colorado river gorge pretzel twists and moab utah coloradoriver coloradoriver_1983 colorful autumn folliage covers the mountains bordering the sinks of the little river by little river road within great smoky mountains national park during autumn usa nc tn gatlinburg colorful cliffs dwarfing canoeists in apple river canyon state park colorful cliffs dwarfing open canoeists in apple river canyon state park colorful cliffs tower over hikers within colorado river's rugged north canyon of the grand canyon national park usa az grand canyon colorful confluence of the wild sunwapta and athabasca rivers within jasper national park can alberta jasper colorful contrasts of redrock sidecanyons and blue skies near the colorado river within grand canyon national park usa az grand canyon colorful granitic escarpments tower over kayakers bouncing through big boulder mined drops within the class 3 to 4 lochsa river canyon colorful iridescent bold wild turkey during springtime within longenecker gardens of the university of wisconsin madison arboretum usa wi madison colorful iridescent bold wild turkey within longenecker gardens of the university of wisconsin madison arboretum usa wi madison colorful kayakers in boiling eddy colorful landscapes of bryce canyon national park usa ut 84764 colorful limestone bluffs colorful limestone cliffs dwarf colorado river paddlers between vasey's paradise and redwall canyon within grand canyon national park usa az grand canyon colorful mountains embrace the top of kennicott glacier near mount blackburn northwest of kennicott within wrangell st. elias national park and preserve usa alaska mccarthy colorful sculpted limestone cliffs in maligne river canyon within jasper national park colorful solo woman kayaker marie grange of france negotiates slalom gate during 1989 world cup on the lower wausau whitewater course of the wisconsin river in downtown wausau columbia combined images in photoshop captured from the same spot american bald eagles soaring towards me while silhouetted by fog near the sterling highway by homer on the western kenai peninsula of alaska usa alaska homer common perennial asiatic lily liliaceae lilium asiatic hybrids asiatic lilies competion competition triathlon wolfman usa wi langlade white lake complex ledges of silver cataract in the tiefenbach klamm challenge kayakers on the brandenburger ache river complex ledges of tiefenbach klamm's silver cataract challenge kayakers on the brandenburger ache river austria tyrol kramsach concentration and chaos for a kayaker blasting through sherry rapids during the 2014 wolfman triathlon at 912 cubic feet per second or 8.91 ft on the langlade usgs gauge on section 2 of the wild wolf river concentration and chaos for a tandem kayak women's team in lower sherry rapids during the 2014 wolfman triathlon at 912 cubic feet per second or 8.91 ft on the langalde usgs gauge on section 2 of the wild wolf river concentration and chaos for hundreds of canoe and kayak competitors during the 2014 wolfman triathlon in sherry rapids at 912 cubic feet per second 8.91 ft on the langalde usgs gauge on section 2 of the wild wolf river concentration and chaos for hundreds of canoe and kayak competitors during the 2014 wolfman triathlon in sherry rapids at 912 cubic feet per second 8.91 ft on the langlade usgs gauge on section 2 of the wild wolf river conservanydbobst.liss.mmao_9088_usa.wi.middleton.orangesunriseoverlakemendotaandwistatecapitolb consolation lakes trail by moraine lake within banff national park consolation lakes trail by moraine lake within banff national park of canada constricted limestone embrace the maligne river and its cascades within maligne canyon and within jasper national park constricted temperance river gorge contestdbobst.liww_5547_usa.wi.waunakee.orangesunsetoverlakemendotaandstatewicapitol.gnspb continent europe and country austria and state tyrol and district lienz and city obertilliach continental divide continuous class iv rapids continuous pounding class 4 to 5 rapids for over 30 miles through a roadless area challenges expert whitewater kayakers at high water in the south fork of the salmon river canyon cool temperance river pool at temperance river state park usa mn silver bay copper falls state park copper falls state park map and trails sign copper harbor golden evening light silhouettes trees and shores copper harbor sunset copper harbor sunset orange afterglow silhouettes lake superior shores and trees copperharbor copycrop01 copycropvert copycropvert01 copycropvert02 copyright copyright by colleen e. hayes and robert a. obst copyright by robert arthur obst copyright holder imagery creation evangelist robert obst captured these images with a nikon d800 digital camera copyright © robert arthur obst copysupercrop01 copysupercrop02 cotton candy clouds cotton candy clouds and deep snow cover the coast mountains and juneau icefield within the tongass national forest during midsummer usa alaska juneau cotton candy clouds embrace snowy coast mountains and amherst peak near mendenhall glacier within the tongass national forest usa alaska juneau cotton candy clouds embrace the juneau icefield and its snowy landscapes such as amherst peak within the tongass national forest usa alaska juneau courageous canoeist rides bucking open canoe in huge standing waves in gilmores mistake rapids on the wild wolf river courageous travelers on goingtothesun road will discover spectaclar views such as 492 feet high bird woman falls within glacier national park courageous trend setting squirrel called skippy made our peanut butter jar famous courageous veteran canoeist charlie frisk expertly backsurfing his open canoe in a white water curler of gilmore's mistake rapids at 619 cfs on section 3 of the wild wolf river usa wi white lake courageous veteran canoeist charlie frisk expertly backsurfing his open canoe in a white water curler of gilmore's mistake rapids on the wild wolf river usa wi white lake creative imagery by bob obst creative imagery by bob obst © robert arthur obst adventure travel obst httpwww.robertarthurobstphotos.comadventurestravel creative imagery by imagery creation evangelist robert obst or b creative imagery by imagery creation evangelist robert obst or bob obst images and photography and capturing memories creative imagery by robert obst creative imagery by robert obst bob obst imagesphotography creative imagery by robert obst nikon d810 adventures paddlesport whitewater fav image 3215 creative imagery by robert obst nikon d810 daily best obst image 3245 creative imagery by robert obst nikon d810 daily best obst image 3259 creative imagery by robert obst nikon d810 destinations wild scenic rivers creeks lakes fav image 3201 creative imagery by robert obst nikon d810 destinations wild scenic rivers creeks lakes image 3251 creative imagery by robert obst nikon d810 fav landscapes inspirational autumn beauty image 3187 creative imagery by robert obst nikon d810 fav landscapes inspirational autumn beauty image 3190 creative imagery by robert obst nikon d810 landscapes inspirational autumn beauty image 3240 creative imagery by robert obst nikon d810 landscapes inspirational autumn beauty image 3248 creative imagery by robert obst nikon d810 landscapes inspirational autumn beauty image 3279 creative imagery by robert obst nikon d810 landscapes inspirational river valley image 3246 creative imagery by robert obst nikon d810 landscapes inspirational wolf river refuge favs image 3242 creative imagery by robert obst nikon d810 landscapes inspirational wolf river refuge favs image 3276 creative imagery by robert obst nikon d810 madison middleton are creative imagery by robert obst nikon d810 madison middleton area outings treinen farm images creative imagery by robert obst nikon d810 nature enchanting wolf river refuge favorites image 3191 creative imagery by robert obst nikon d810 wolf river refuge outings canoe kayak image 3215 creative imagery by robert obst or bo creative imagery by robert obst or bob obst images and photogra creative imagery by robert obst or bob obst images and photography and capturing memories creative imagery by robert obst or bob obst images and photography and capturing memories at creative imagery by © imagery creation evangelist robert arthur obst creative imagery by © imagery creation evangelist robert arthur obst creative imagery by © robert arthur obst creative imagery by © robert arthur obst creative imagery by © robert arthur obst 6086586116 creative imagery by © robert arthur obstst creek and mountains view creek late afternoon sun crimson crimson and serpentine colorado river gorge at dead horse point crimson autumn foliage and cobalt blue skies encircle elephant rock near east bluff trail within devils lake state park crimson autumn foliage embraces sherry rapids along the wild wolf river usa wi white lake crimson autumn foliage frames a tandem canoe in little slough gundy rapids on the wild wolf river usa wi white lake crimson colorado river gorge at dead horse point crimson oaks and colorful bluffs frame the south shore of the windrippled lake within devils lake state park crimson sky over the wild wolf river between cedar and sherry rapids at sunset usa wi white lake langlade crimson sunrise over grewingk glacier and the kenai mountains within kachemak bay state park on the kenai peninsula usa alaska homer crimson sunrise over lake mendota and the wisconsin state capitol from governor nelson state park borchers beach road usa wi waunakee crimson sunrise over lake mendota and wi state capitol from governor nelson state park usa wi waunakee crimson sunrise over lake mendota and wisconsin state capitol of madison from governor nelson state park crimson sunrise over lake mendota geese and ducks on bishops bay and the wisconsin state capitol usa wi middleton crimson sunrise over lake mendota geese and ducks on bishops bay and wisconsin state capitol usa wi middleton crimson sunrise over lake mendota's bishops bay and the state capitol of madison wisconsin with mist and ducks usa wi middleton crimson sunrise over the wisconsin state capitol of madison and lake mendota geese and ducks on bishops bay crimson sunset afterglow over colorful flower gardens in southwestern wisconsin usa wi dodgeville crimson sunset over central wisconsin highway 21 after rainfall near coloma usa wi coloma crimson sunset over ohio woodlands as seen from us highway 27 northwest of oxford and miami university of ohio usa oh oxford crimson sunset over ohio woodlands from us highway 27 northwest of oxford and miami university of ohio usa oh oxford crimson sunset over ohio woodlands near oxford crimson sunset over the wild wolf river near the wolf river refuge within northeastern wisconsin usa wi white lake crimson sunset silhouetting a pirouetting lake canoeist near the matawaska river crimson sunset silhouetting lake canoeist near matawaska river crop cropcc01 cropcc02 cropcc03 cropcc04 cropcc05 crophoriz crophorizhr crophorizontalhr cropped croppedright croppedv croppedvert croppedvertical croppedwithchick cropspecial cropvert cropvert01hr cropverthr cropverticalhr cross country ski trails within porcupine mountains wilderness state park cross country skier chasing through fresh snow a fading red setting sun within governor nelson state park cross country skier framed by gorgeous oak trees on morningside trail within governor nelson state park cross country skier under oak limbs on morningside trail within governor nelson state park cross country skier's and hiker's view from the woodland trail of oak trees and a frozen lake mendota and the state of wisconsin capitol of madison within governor nelson state park usa wi waunakee cross country skier's and hiker's winter view from the woodland trail of oak trees framing a crimson sunrise over a frozen shining lake mendota within governor nelson state park usa wi waunakee cross country skier's and snowshoer's and ice fisherperson's view from the woodland trail within governor nelson state park of oak trees and a frozen lake mendota and the state of wisconsin capitol of madison usa wi waunakee cross country skier's and snowshoer's and ice fisherperson's view of oak trees framing lake mendota and the state of wisconsin capitol of madison within governor nelson state park cross country skier's and snowshoer's view of oak trees framing lake mendota and the state of wisconsin capitol of madison within governor nelson state park usa wi waunakee cross country skier's and winter camper's gorgeous view of brilliant blue skies over a winter wonderland between cedar and sherry rapids on section 2 of the wild wolf river usa wi langlade cross country skier's ascent of a steep section of the north loop trail between fanny lake and sawyer lake road access within the jones springs management area of the nicolet national forest usa wi townsend cross country skier's gorgeous view of afternoon winter sun over deep hardwood forests within indian lake county park usa wi cross plains cross country skier's new year day's view of a partially frozen lake mendota during a winter evening rosy sunset within governor nelson state park cross country skier's new year day's view of a partially frozen lake mendota during a winter evening rosy sunset within governor nelson state park usa wi middleton cross country skier's new year day's view of picnic area framed by rosy evening light along partially frozen lake mendota within governor nelson state park usa wi middleton cross country skier's view during the last official day of winter from the woodland trail of an early evening pink sunset after glow over lake mendota within governor nelson state park cross country skier's view during winter of evening shadows highlighting hardwoods and snow within the university of wisconsin madison arboretum usa wi madison cross country skier's view from the woodland trail of an early evening pink sunset after glow over lake mendota within governor nelson state park cross country skier's view from the woodland trail of pink sunset after glow over lake mendota within governor nelson state park usa wi waunakee cross country skier's view from the woodland trail of the late afternoon sun highlighting wind rippled snow fields a radiant oak forest within governor nelson state park usa wi waunakee cross country skier's view from the woodland trail of the late afternoon sun highlighting wind rippled snow fields and a radiant oak forest within governor nelson state park usa wi waunakee cross country skier's view of a tributary of lake wingra near big spring within the university of wisconsin madison arboretum cross country skier's view of afternoon early spring sun and blue skies over snowy farm fields near indian lake county park usa wi cross plains cross country skier's view of afternoon winter sun over hardwood forests and a frozen indian lake within indian lake county park usa wi cross plains cross country skier's view of afternoon winter sun over oak and birch woods within indian lake county park usa wi cross plains cross country skier's view of blue skies over a paper birch tree or betula papyrifera by frozen indian lake within indian lake county park usa wi cross plains cross country skier's view of blue skies over snowy forest and prairie within the university of wi madison arboretum cross country skier's view of blue skies over snowy forest within the university of wi madison arboretum cross country skier's view of estuary of lake wingra near big spring within the university of wisconsin madison arboretum cross country skier's view of intricate branches of an oak or quercus woods during winter evening sunset within governor nelson state park usa wi middleton cross country skier's view of intricate branches of an oak woods during winter evening sunset within governor nelson state park usa wi middleton cross country skier's view of oak trees from the woodland trail within governor nelson state park usa wi waunakee cross country skier's view of snow covered hardwood forests within the university of wisconsin madison arboretum cross country skier's view on the last day of winter from the woodland trail of an early evening pink sunset after glow over lake mendota within governor nelson state park usa wi waunakee cross country skier's winter beauty view of an emerald lake wingra tributary near big spring within the university of wisconsin madison arboretum cross country skier's winter beauty view of the last rays of sun over lost city forest within the university of wisconsin madison arboretum cross country skier's winter beauty view of the last rays of sun over wingra woods near big spring and lake wingra within the university of wisconsin madison arboretum cross country skier's winter view of a serpentine emerald estuary of lake wingra near big spring within the university of wisconsin madison arboretum usa wi madison cross country skier's winter view of a serpentine emerald tributary of lake wingra near big spring within the university of wisconsin madison arboretum usa wi madison cross country skier's winter view of evening light and shadows highlighting oak or quercus woods and snow covered lake wingra within the university of wisconsin madison arboretum cross country skier's winter view of evening shadows highlighting oak or quercus woods and snow covered lake wingra within the university of wisconsin madison arboretum usa wi madison cross country skier's winter view of fresh snow over hardwood forests within the university of wisconsin madison arboretum usa wi madison cross country skier's winter view of wild turkeys or meleagris gallopavo feeding within longenecker gardens of the university of wisconsin madison arboretum usa wi madison cross country skier's winter view winter of evening light and shadows highlighting hardwoods and snow during sunset within the university of wisconsin madison arboretum cross country skiers enjoy gorgeous winter views of glaciated boreal forest terrain from winding eskers along the north loop trail within the jones springs management area of the nicolet national forest cross country skiers late afternoon view of the ice and snow covered bottom of sherry rapids on section 2 of the wild wolf river cross country skiers new year's day view southeast over lake mendota of snow geese and partially fozen turquoise blue waters from governor nelson state park usa wi middleton cross country skiers sunny and clear skies view of the ice and snow covered sherry rapids on section 2 of the wild wolf river cross country skiers view at dusk with blowing snow and large snow flakes gently drifting over oak woods at dusk within governor nelson state park cross country skiers view during winter from the east vista of partially forzen lake superior within porcupine mountains wilderness state park usa mi silver cityontonagon cross country skiers view during winter with late afternoon light southeast across lake mendota from governor nelson state park of snow geese swimming and taking off cross country skiers view of a silhouetted oak under sunny skies from the woodland trail within governor nelson state park usa wi waunakee cross country skiers view of a snowy oak woods within governor nelson state park usa wi waunakee cross country skiers view of a snowy winter wonderland over pine forests along the east loop trail within the jones springs management area of the nicolet national forest cross country skiers view of afternoon sparkling sun under crystalline blue skies over a majestic oak or quercus within owen conservation park usa wi madison cross country skiers view of clear blue skies over birch and oak woods during winter within indian lake park of dane county usa wi cross plains cross country skiers view of evening sun under clear skies over a majestic oak or quercus within owen conservation park usa wi madison cross country skiers view of evening sun under clear skies over majestic oaks or quercus within owen conservation park usa wi madison cross country skiers view of the last rays of the setting sun under clear skies over indian lake park of dane county usa wi cross plains cross country skiers view south across lake mendota from governor nelson state park of snow geese flying and of the state of wisconsin capitol of madison cross country skiers view south across lake mendota from governor nelson state park of snow geese flying and of the state of wisconsin capitol of madison usa wi middleton cross country skiers view southeast across lake mendota from governor nelson state park of snow geese swimming and taking off usa wi middleton cross country skiers winter cross country skiers winter beauty view noth towards the wolf river refuge of afternoon sunlight over ice and snow encrusted sherry rapids on section 2 of the wild wolf river cross country skiers winter beauty view south of afternoon sparkling sunlight over ice and snow encrusted sherry rapids on section 2 of the wild wolf river usa wi langlade cross country skiers winter late afternoon view south across lake mendota from governor nelson state park of snow geese flying and of the state of wisconsin capitol of madison cross country skiers winter view north of late afternoon sun rays over the ice and snow covered sherry rapids on section 2 of the wild wolf river usa cross country skiers winter view of a lonely paper birch tree or betula papyrifera over the ice and snow covered cedar rapids on section 2 of the wild wolf river cross country skiers winter view south over the ice and snow covered cedar rapids on section 2 of the wild wolf river usa wi white lake langlade cross country skiers winter view southeast with late afternoon light across lake mendota from governor nelson state park of snow geese swimming usa wi middleton cross country skiing cross country skiing on the east loop trail across mary creek within the jones springs management area of the nicolet national forest usa wi townsend cross country skiing on the east loop trail through a red pine or pinus resinosa plantation within the jones springs management area of the nicolet national forest usa wi townsend cross country skiing over the ice and snow covered sherry rapids on section 2 of the wild wolf river cross country skiing the trails of dane county's indian lake county park during winter cross country skiing under brillant blue skies past oak trees on morningside trail within governor nelson state park usa wi waunakee crossplains cruise ships on the gastineau channel of the pacific ocean at the port of juneau usa alaska juneau cruising and kayaking within the inland passages to the sounds a cruising and kayaking within the inland passages to the sounds and and views of whales and dolphins and eagles within the gulf of alaska of the pacific ocean between ketchikan and homer alaska between the 13 july 2011 and the 26 of july 2011 cruising between glacier bay and college fjord cruising the inland passage from canada vancouver burrard inlet pacific ocean port of vancouver to ketchikan alaska usa cruising the inside passage from the burrard inlet pacific ocean port of vancouver to juneau alaska usa cruising the inside passage from the burrard inlet pacific ocean port of vancouver to ketchikan alaska and to jueau alaska usa cruising the inside passage from the burrard inlet pacific ocean port of vancouver to ketchikan alaska usa cruising the inside passage from the burrard inlet pacific ocean port of vancouver to ketchikan alaska usa and to juneau alaska usa cruising the inside passage from the burrard inlet pacific ocean port of vancouver to skagway alaska to glacier bay national park and preserve cruising the inside passage from the burrard inlet pacific ocean port of vancouver to skagway alaska usa cruising the inside passage or inland passage from canada vancouver burrard inlet pacific ocean port of vancouver to ketchikan alaska usa crusing the sounds and inland passages to views and sounds of wh crusing the sounds and inland passages to views and sounds of whales and dolphins and eagles within the gulf of alaska of the pacific ocean between ketchikan and haines alaska on 13 july 2011 crusing the sounds and inland passages to views of whales and do crusing the sounds and inland passages to views of whales and dolphins and eagles within the gulf of alaska of the pacific ocean between ketchikan and glacier bay alaska usa ak glacier bay crusing the sounds and inland passages to views of whales and dolphins and eagles within the gulf of alaska of the pacific ocean between ketchikan and haines alaska on 13 july 2011 crusing the sounds and inland passages to views of whales and dolphins and eagles within the gulf of alaska of the pacific ocean between ketchikan and haines alaska on 13 july 2011 usa ak collegefjord crusing the sounds and inland passages to views of whales and dolphins and eagles within the gulf of alaska of the pacific ocean between ketchikan and haines alaska on 13 july 2011 usa ak glacier bay crusing the sounds and inland passages to views of whales and dolphins and eagles within the gulf of alaska of the pacific ocean between ketchikan and haines alaska on 13 july 2011 usa ak gustavus crusing the sounds and inland passages to views of whales and dolphins and eagles within the gulf of alaska of the pacific ocean between ketchikan and haines alaska on 13 july 2011 usa ak halibut cove crusing the sounds and inland passages to views of whales and dolphins and eagles within the gulf of alaska of the pacific ocean between ketchikan and haines alaska on 13 july 2011 usa ak juneau crusing the sounds and inland passages to views of whales and dolphins and eagles within the gulf of alaska of the pacific ocean between ketchikan and haines alaska on 13 july 2011 usa ak mccarthy crusing the sounds and inland passages to views of whales and dolphins and eagles within the gulf of alaska of the pacific ocean between ketchikan and haines alaska on 13 july 2011 usa ak seward crusing the sounds and inland passages to views of whales and dolphins and eagles within the gulf of alaska of the pacific ocean between ketchikan and haines alaska usa ak seward crusing the sounds and inland passages to views of whales and dolphins and eagles within the gulf of alaska of the pacific ocean between ketchikan and homer alaska on 13 july 2011 crusing the sounds and inland passages to views of whales and dolphins and eagles within the gulf of alaska of the pacific ocean between ketchikan and homer alaska usa ak halibut cove crusing the sounds and inland passages to views of whales and dolphins and eagles within the gulf of alaska of the pacific ocean between ketchikan and mccarthy alaska usa ak mccarthy crusing the sounds and inland passages to views of whales and dolphins and eagles within the gulf of alaska of the pacific ocean between ketchikan and seward alaska usa ak seward crusing the sounds and inland passages within the gulf of alaska of the pacific ocean between ketchikan and homer alaska crystal clear blue skies over mount oberlin from goingtothesun road near logan pass within glacier national park usa mt west glacier crystal clear blue skies umbrella a replica of the 1893 forward wisconsin women memorial statue by jean pond miner near the state of wisconsin capitol usa wi madison crystal clear blue skies umbrella the state of wisconsin capitol in all of its resplendent glory usa wi madison crystal clear blue skies umbrella towering grace episcopal church near the state of wisconsin capitol usa wi madison crystal clear day for whitewater kayaker in lower tea kettle rapids on section four of the wild and scenic wolf river usa wi keshena crystalline areated river whitewater crystalline bowman lake crystalline bowman lake mountains view crystalline swiftcurrent lake crystalline water cultivated apricot tree or ansu apricot or siberian apricot or tibetan apricot of the kingdom plantae and angiosperms and eudicots and rosids and order rosales and family rosaceae and genus prunus and subgenus prunus and section armeniaca and species p. armeniaca cumulus and storm clouds' reflections over the salt river and a canoe near alpine wyoming major retirement adventure travel by robert arhtur obst tofrom usa wy 13 to 27 of may 2015 spring into yellowstone events including selfguided tours of yellowstone national park and grand teton national park areas and return to usa wi middleton usa wy alpine cumulus clouds' reflections over the salt river and a canoe near alpine wyoming major retirement adventure travel by robert arhtur obst tofrom usa wy 13 to 27 of may 2015 spring into yellowstone events including selfguided tours of yellowstone national park and grand teton national park areas and return to usa wi middleton usa wy alpine cumulus clouds' reflections over the salt river near alpine wyoming major retirement adventure travel by robert arhtur obst tofrom usa wy 13 to 27 of may 2015 spring into yellowstone events including selfguided tours of yellowstone national park and grand teton national park areas and return to usa wi middleton usa wy alpine curious albino coyote shadowing our vehicle off grand loop road near west thumb geyser basin in yellowstone national park curious spectators watch open canoe bucking huge standing waves during high flows in gilmores mistake rapids on the wild wolf river usa wi white lake current daily popular images by bob obst current daily popular or fav images by bob obst customers are entertained by the colorful decorated ceiling of the yankee doodles cafe within alpine wyoming major retirement adventure travel by robert arhtur obst tofrom usa wy 13 to 27 of may 2015 spring into yellowstone events including selfguided tours of yellowstone national park and grand teton national park areas and return to usa wi middleton usa wy alpine cyclops roller coaster mt olympus water and theme park wisconsin dells wi usa czech republic slalom whitewater kayaking d300s d800 d810 daaquatic_3220_dbo.dwsh.can.ab.banffbanffnp.johnstoncanyon270dbendjohnstoncreekb dad pulling kid's ski trailer through a winter wonderland within governor nelson state park usa wi waunakee daily daily awards 5 march 2011 submission aquatic daily awards submission daily best images by bob obst daily best images by bob obst or robert obst daily best images by creative imagery by robert arthur obst daily best obst image collage by bob obst or robert obst daily best of fav images by bob obst daily best of fav images by robert a. obst daily best of fav photos or images by bob obst daily best of favorite photos by bob obst daily best or daily favorite picturs by bob obst daily best or fav images by bob obst daily best or fav images by bob obst or robert obst daily best or fav images by creative imagery by robert obst daily best or fav images by imagery creation evangelist robert obst or bob obst daily best or fav images by robert arthur obst daily best or fav images by robert arthur obst or bob obst daily best or fav images by robert obst daily best or fav images by robert obst or bob obst daily best or fav images creative imagery by robert arthur obst daily best or fav images of creative imagery by bob obst or robert obst daily best or fav images of creative imagery by robert obst or bob obst daily best or fav obst team canada bib number 10 ford david and tayler michael and hayward ben racing in the kayak single men slalomwhitewater finals cksw final 20 sept 2014 start time 1547 at the 2014 'deep creek' icf or international canoe federation world championships within the adventure sports center international or asci site near deep creek lake and mchenry md usa usa md mchenry daily best or fav photos by bob obst daily best or fav photos of bob obst daily best or favorite images by bob obst daily best or favorite images by bob obst or robert obst daily best or favorite images by imagery creation evangelist robert obst or bob obst daily best or favorite images by imagery creation evangelist robert or bob obst daily best or favorite or fav images by bob obst daily best or favorite or fav images by bob obst or robert obst daily best or favorite photos by bob obst daily best or favorite photos of bob obst daily best or favorite photos or images by bob obst daily best photos by bob obst daily best photos of bob obst daily best photos of bob obst 2010 daily best photos of bob obst 22 august 2010 daily best photos or images by bob obst daily best travel obst daily fav or best photos of bob obst daily favorite or best photos by bob obst daily favorite or best photos of bob obst daily favorite or daily best photos by bob obst daily favorite or fav or best photos by bob obst daily favorite photos by bob obst daily photos daily photos by bob obst daily photos of bob obst dailyfavs dall sheep dall sheep near denali park road and polychrome pass within denali national park usa alaska denali park dall sheep or dall's sheep or ovis dalli dalles of the st. croix river state natural area dalles of the wolf river danight_0067_ob2007.usa.wi.wrr.ben.wr.moonlightmagicwolfriverbc dao_3036_dwsnpm.can.bc.rhs.skippingsonesovertokummcreekinmarblecanyonb daring intrepid solo expert plunges over golden baer falls within the rugged and gorgeous linville river gorge wilderness usa nc dark cliffs dwarf courageous kayakers who descend the class five 5 kaiser klamm of the brandenburger ache river austria tyrol kramsach date of obst best photo 22 august 2010 date of obst best photo 23 august 2010 date of obst best photo 24 august 2010 date of obst best photo 27 august 2010 date of obst photo best 23 august 2010 date of photo 18 august 2010 dave's falls county park in marinette county wisconsin near amberg day 15 of bob obst major adventure travel phase six image capture date 07 july 2014 in the sunshine meadows area of banff national park canada day 15 of bob obst retirement major adventure travel phase six image capture date 07 july 2014 in the sunshine meadows area of banff national park canada day 15 of obst major adventure travel phase six image capture date 07 july 2014 in the sunshine meadows area of banff national park canada day 15 of obst retirement major adventure travel phase six image capture date 07 july 2014 in the sunshine meadows area of banff national park canada day 16 8 july 2014 hiking in the johnston canyon area of banff national park within alberta canada by bob obst retirement major adventure travel program phase six day 16 8 july 2014 touring the fairmont banff springs hotel within banff alberta canada and banff national park by bob obst retirement major adventure travel program phase six day 16 of bob obst retirement major adventure travel phase six image capture date 08 july 2014 in the sulphur mountain near banff area via the banff gondola within banff national park of canada dazzling dazzling crimson autumn sunset from a canoe through fog and storm over wisconsin river near tomahawk dazzling crimson autumn sunset through fog and storm over wisconsin river near tomahawk usa wi tomahawk dazzling crimson autumn sunset through fog contrasts with shadowed wisconsin river banks near tomahawk wisconsin dazzling crimson autumn sunset through fog over the wisconsin river near tomahawk usa wi tomahawk dazzling crimson autumn sunset through fog over wisconsin river near tomahawk usa wi tomahawk dazzling crimson autumn sunset through the fog contrasts with shadowed wisconsin river banks near tomahawk wisconsin dazzling iridescent double rainbow at sunset during a rainstorm over lake mendota park usa wi middleton dazzling iridescent rainbow at sunset during a rainstorm over lake mendota park usa wi middleton dazzling iridescent rainbow at sunset during rainstorm over lake mendota park usa wi middleton dazzling iridescent red double rainbow at sunset during a rainstorm over lake mendota park usa wi middleton dazzling lake superior copper harbor michigan sunset dazzling lake superior copper harbor michigan sunset from hobard state park dazzling lake superior copper harbor michigan sunset usa mi copper harbor dbo dbo2010.hsi_1251_mmaorb.rhythmboomsfireworksfromgnspb dbo_04850479c_usa.ak09chenahotspringsaktomccarthyak.historicalrichardsonhwydeltarivvalleyneardonnelly.mooseb dbo_0487_ato2007.usa.can.on.pnp.pulpwoodharbour.winddrivenwavesabovegraniteb dbo_3644_mmaoilcp.usa.wi.crossplains.brilliantautumncolorswithinindianlakecountypark.trailrunnerb dbo_4128_liw.oatw.can.bc.field.yohonp.takakkawfallsb dbo_5300_lisas.ote.usa.oh.oxford.sunsetoverwoodlandsnwofoxfordmiamiunivbyus27b dbo_5315_lisas.ote.usa.oh.oxford.sunsetoverwoodlandsnwofoxfordmiamiunivbyus27b dbo_7454_mmafouwm.usa.wi.madison.uwm.bittercoldblueskiesoverwarfandwmadisoncampuscogenerationfacilityb dbo_7891_dwh.ato2011ak04skagwayaktoglacierbayak.usa.ak.skagway.taiyainlet.skagwayharbor.graniteshorelinesb dbobst dbobst dwsnpm_4149_can bc field yohonp takakkawfallsb dbobst neaw mmofj_2496_usa wi middleton birthofbunnieslawnb dbobst sfeao apw_4504_usa wi wolfriver gilmoresmrapidshwocb dbobst.ato2010.dwsnpm_3280_can.ab.banffnp.gondola.viewfromsulphurmtnb dbobst.ato2010.dwsnpm_3285_can.ab.banffnp.gondola.viewfromsulphurmtnb dbobst.ato2010.dwsnpm_3369_can.ab.banffnp.morainelake.canoesb dbobst.ato2010_3462_lim.can.ab.banffnp.waputikmtns.mistayariv.emeraldwatersb dbobst.ato2011.usa.ak dbobst.ato2011.usa.ak_0368_ak08denaliparkaktochenahotspringsak.denalinationalpark.denalipkroad.dallsheepb dbobst.ato2011.usa.ak_7108_ato2011ak1vancouverbccantoketchikanak.waterfrontwalkburrardinlet.gorgeousportofvancouverb dbobst.ato2011.usa.ak_7113_ato2011ak1vancouverbccantoketchikanak.waterfronttrailburrardinlet.portofvancouver.fountainsandarchitectureb dbobst.ato2011.usa.ak_7187_ato2011ak1vancouverbccantoketchikanak.vancouvertopoftheharbourcentretower.viewofstanleyparkandvancouverfromtowertopb dbobst.ato2011.usa.ak_7257_ato2011ak1vancouverbccantoketchikanak.midnightsunoverinlandpassagenorthofvancouver.orangesunsetfromcruiseshipb dbobst.ato2011.usa.ak_7271_ato2011ak1vancouverbccantoketchikanak.morninglightandfogoverinsidepassageandcoastmountainsnorthofvancouverfromcruiseshipb dbobst.ato2011.usa.ak_7275_ato2011ak1vancouverbccantoketchikanak.morninglightandfogoverinsidepassageandcoastmountainsnorthofvancouverfromcruiseshipb dbobst.ato2011.usa.ak_7333_ato2011ak1vancouverbccantoketchikanak.insidepassage.eveninglightviewofcoastmountainsb dbobst.ato2011.usa.ak_7378_ato2011ak2vancouverbccantoketchikanak.mistyfjordstourbyfloatplane.snoweygranitemountainsandestuariesb dbobst.ato2011.usa.ak_7390_ato2011ak2vancouverbccantoketchikanak.mistyfjordsnmbyfloatplane.granitemountainsriseoverremotelakesb dbobst.ato2011.usa.ak_7392_ato2011ak2vancouverbccantoketchikanak.mistyfjordsnmbyfloatplane.granitemountainsriseoverremotelakesb dbobst.ato2011.usa.ak_7398_ato2011ak2vancouverbccantoketchikanak.mistyfjordsnmbyfloatplane.mountainsencirclehiddenvalleylakewaterfallb dbobst.ato2011.usa.ak_7408_ato2011ak2vancouverbccantoketchikanak.mistyfjordsnmbyfloatplane.granitemountainstoweroverbluelakesstreamsb dbobst.ato2011.usa.ak_7440_ato2011ak2vancouverbccantoketchikanak.hollandamericazaandam.insidepassagebetweekketchikanandjuneau.orangesunsetb dbobst.ato2011.usa.ak_7443_ato2011ak2vancouverbccantoketchikanak.hollandamericazaandam.insidepassagebetweekketchikanandjuneau.orangesunsetb dbobst.ato2011.usa.ak_7486_ato2011ak2vancouverbccantoketchikanak.hollandamericazaandam.insidepassageketchiktojuneau.orangesunsetovermountainsb dbobst.ato2011.usa.ak_7566_ak12homeraktohotelalyeskagirdwoodak.neam.akmuskoxalongtrailinalaskawildlifecc dbobst.ato2011.usa.ak_7728_ato2011ak3juneauaktoskagwayak.neam.allenmarinetourswhalewatching.amherstpeakcoastmountainsandkillerwhaleb dbobst.ato2011.usa.ak_9277_ak09chenahotspringsaktomccarthyak.wrangellsteliasnationalpark.willowlakefireweedb dbobst.ato2011.usa.ak_9531_hsi.ato2011ak1vancouverbccantoketchikanak.vancouverarchitecture.greenspacedesignb dbobst.ato2011.usa.ak_9619_ato2011ak1vancouverbccantoketchikanak.insidepassage.hollandamericazaandam.cloudsandturbulentwashb dbobst.ato2011.usa.ak_9633_ato2011ak2vancouverbccantoketchikanak.hollandamericazaandam.insidepassageketchiktojuneau.baroquestyledutchpipeorganu dbobst.ato2011.usa.ak_9636_ato2011ak2vancouverbccantoketchikanak.hollandamericazaandam.insidepassageketchiktojuneau.docksideportofketchikanakb dbobst.ato2011.usa.ak_9650_ato2011ak2vancouverbccantoketchikanak.insidepassageketchikan.whalepark.ketchikanak.chiefkyantotempoleandflowersb dbobst.ato2011.usa.ak_9807_ato2011ak2vancouverbccantoketchikanak.hollandamericazaandam.sportsdecknine.basketballswooshwithstarsbyarob dbobst.ato2011.usa.ak_9821_ak12homeraktohotelalyeskagirdwoodak.neam.friendlygrizzleybearalongtrailinalaskawildlifeccb dbobst.ato2011.usa.ak_9863_ato2011ak3juneauaktoskagwayak.whalewatchingtourboat.leavingaukebay.mendenhallglaicerandcoastmountainsb dbobst.ato2011.usa.ak_9900_dwhiking.ato2011ak3juneauaktoskagwayak.mendenhallglacierbyfloatplane.mendenhallglaicerfromtopb dbobst.collageps dbobst.collageps_0679_nebirds.usa.ak12homeraktohotelalyeskagirdwoodak.kachemakbay.eaglesandwildflowersinfognearkachemakbaybyhomerb dbobst.dwsh.ato2010_2738_hikinghighlinetrail.betweenmtoberlinandmtgouldb dbobst.dwsh_3720_apqm.ato2010.can.ab.jaspernp.malignelakeb dbobst.dwsnp.lim_2968_ato2010.can.bc.rhs.kootenaynpflowersmitchellrangeb dbobst.dwsnpm.ato2010_3036_can.bc.rhs.skippingsonesontokummcreekinmarblecanyonb dbobst.dwsnpm_3377_ato2010.can.ab.banffnp.morainelake.eveninglightb dbobst.dwsnpm_3520_lim.ato2010.can.ab.src.banffnp.cirrusmtnicefieldsparkwayb dbobst.dwsnpm_3577_can.ab.jaspernp.sunwaptarivervalleyatbeautycreekhostelb dbobst.dwsnpm_3607_can.ab.jaspernp.moonoverbeautycreekhostelb dbobst.dwsnpm_3953_lim.can.bc.field.yohonp.freshsnowandfogoverfieldb dbobst.lia_4869_wrr.usa.wi.whitelake.wrr.wolfriverautumnfoliageb dbobst.liab.dwssp_5143_usa.wi.mmo.baraboo.dlsp.cliffscircledevilslake.wbtb dbobst.lic_3685_dwsnpm.ato2010.can.ab.jaspernp.malignerivercanyonb dbobst.lic_3704_dwsnpm.ato2010.can.ab.jaspernp.malignerivercanyonb dbobst.ligv_0733_ob2008.atw.usa.wy.ynp.glr.fpp.sgub dbobst.lim.dwh_3781_ato2010.can.ab.jaspernp.hikersviewathabascarivervalleyb dbobst.lim_3295_ato2010.dwsnpm.can.ab.banffnp.viewofbanfffromsulphurmtnb dbobst.lim_3448_ato2010.can.ab.src.banffnp.waputikmountainswaterfowllakesb dbobst.lim_3448_ato2010.can.ab.src.banffnp.waputikmountainswaterfowllakesb2 dbobst.lim_3536_ato2010.can.ab.jaspernp.columbiaicefieldnearsunwaptapassb dbobst.lim_3674_ato2010.can.ab.jaspernp.athabascarivervalleymountainsb dbobst.lim_3750_ato2010.can.ab.jaspernp.malignerivervalleyb dbobst.lis_5338_usa.wi.middleton.sunriseoverlakemendotaandmadisonwicapitolatgnspb dbobst.liss.mmao_5337_usa.wi.waunakee.hikersviewredsunriselakemendotagnspb dbobst.liss.mmao_9117_usa.wi.waunakee.orangesunriseoverlakemendotaatgovernornelsonspb dbobst.liww_5630_usa.wi.madison.orangesunsetafterglowoverlakemendotaatmarshallparkb dbobst.usa.ak_7584_ato2011ak3juneauaktoskagwayak.insidepassagebyhollandamerica.cloudsembracesnowycoastmtnsamherstpeakb dbobst.usa.ak_7612_neawbirds.ato2011ak3juneauaktoskagwayak.insidepassagebyhollandamerica.lynncanalbyaukebay.baldeaglesb dbobst.usa.ak_7732_ato2011ak3juneauaktoskagwayak.insidepassagebyhollandamerica.lynncanalbyaukebay.coastmtnsframekillerwhaleb dbobst.usa.ak_7798_ato2011ak3juneauaktoskagwayak.allenmarinetourswhalewatching.humpbackwhalesbubblenetfishingbyourboatb dbobst.wrr.ben_0118_nebirds.hummingbirdclearwingmothinflowergardenwithinwolfriverrefugeb dbobst.wrr.ben_0118_nebirds.hummingbirdmothinflowergardenwithinwolfriverrefugeb dbobst.wrr.ben_1674_nefff.flowergardenwithinwolfriverrefuge.magentaclematisb dbobst2010.dwsnpmcan_2967_kootenaynpflowersmitchellrangeb dbobst2010.liab_8949_usa.mi.ontonagon.pmwsp.lakeclouds.autumnbeautyb dbobst2011.hsieventspeople_7046_wrrevents.fireworksoverwhitelake.fourthofjulyb dbobst2011.neaw_6245_uwmhocalumnioutings.usa.wi.whitelake.wrr.alligatorsnappingturtleu dbobst_0052_nemm.wrr.ben.honeybeesoncommonthistlebywolfriverwithinwrrnewib dbobst_0180.f_ob2009.usa.wi.mmo.baraboo.dlsp.ebt.vnw.autumnmagicb dbobst_0183_lim.ak08denaliparkaktochenahotspringsak.denalinp.mountmckinleyfromdenalipkrdb dbobst_0188_nemm.wrr.ben.honeybeeoncommonthistlebywolfriverwithinwrrnewib dbobst_0193_lim.ak08denaliparkaktochenahotspringsak.denalinp.mountmckinleyfromdenalipkrdb dbobst_0258_lim.ak08denaliparkaktochenahotspringsak.denalinp.mountmckinleyfromdenalipkrd.wildlifesightingscollageb dbobst_0375_ato2011.usa.akak08denaliparkaktochenahotspringsak.denalinp.denalipkrd.dallsheepb dbobst_0377_ato2011.usa.akak08denaliparkaktochenahotspringsak.denalinp.denalipkrd.dallsheepb dbobst_04860479c_usa.ak09chenahotspringsaktomccarthyak.historicalrichardsonhwydeltarivvalleyneardonnelly.moosegrazingbc dbobst_05020503c_usa.ak09chenahotspringsaktomccarthyak.richardsonhwydeltarivvalley.rainbowridgebyphelanckb dbobst_0580_liss.usa.wi.polar.autumnsunsetandmuellerlakeb dbobst_0735_usa.wy.yellowstonenationalpark.grizzlybearcrossingyrtributarywithinhaydenvalleyb dbobst_0937_nebirds.ob2012.mmao.usa.wi.uwmarboretum.explosionofapplebloomsoverwildturkeyb dbobst_0960_ob2012.mmao.usa.wi.uwmarboretum.explosionofapplebloomsoverwildturkeyb dbobst_0981_liab.usa.wi.whitelake.wrrohiking.wolfriver.section3.boyscoutsrapidsb dbobst_1056_usa.wi.mmo.baraboo.dlsp.devilslake.blueskiesovereastblufftrailandturquoisedevilslakeb dbobst_1150_liwaterfalls.usa.wy.yellowstonenationalpark.gibbonriver.gibbonfallsb dbobst_1179_mmajh.usa.wi.middleton.catsinlove.autumnbreezeobstandwinterfrostobstb dbobst_1193_mmajh.usa.wi.middleton.catsinlove.autumnbreezeobstandwinterfrostobstb dbobst_1230_lis.wrrhl.usa.wi.whitelake.wolfriverrefuge.crimsonsunsetoverwildwolfrivernearwolfriverrefugeu dbobst_1312_wrrock.whitelake.wi.reflectionsoverwolfrivercanoebetweenotterslideandsullivanfallsb dbobst_1390_usa.wi.statenaturalareas.ferrybluff.viewupwiriverthroughoaksfromferrybluffb dbobst_1398_keshenawi.breakingwaveovercanoeinducknestrapids.oc1.charlesfriskb dbobst_1399_usa.wi.whitelake.wolfriverbywolfriverrefuge.blueskiesovercedarrapidshighflow.lastdaywinter2012b dbobst_1518_wrrock.keshenawi.wolfriver.s4gorgeousreflectionsbetweendalleswolfandbigsmokeyfallsat744cfs.oc1.friskb dbobst_1547c6_wrrock.keshenawi.canoesweetrouteoverbigsmokeyfallsat744cfs.bobobstb dbobst_1573_keshenawi.turbulenceengulfssolocanoeistinbigsmokeyfalls.oc1.charlesfriskb dbobst_1621_wrrenb.usa.wi.whitelake.firstirisofseasonatwolfriverrefugeb dbobst_1627_wrrenb.usa.wi.whitelake.firstirisofseasonatwolfriverrefugeb dbobst_1865_wrroutingsckusa.wi.langlade.wolfriver.s3.youthraftersridingboyscoutsrapidsb dbobst_1941_wrroutingsckusa.wi.langlade.wolfriver.s3.youthraftersridinghansonsrapidsb dbobst_2184_mmaob.usa.wi.lakemills.hotairballooningwithaeroworksballoons.excitementrisesasballoonistslookforaplacetolandb dbobst_2265c_apwwc.usa.wi.wausau2012icfjunioru23canoeslalomworldchampusa.c1jr.sanbornandreb dbobst_2338c_apwwc.usa.wi.wausau2012icfjunioru23canoeslalomworldchamprussia.c1jr.snegirevyurib dbobst_2363c_apwwc.usa.wi.wausau2012icfjunioru23canoeslalomworldchamprussia.c1jr.smirnovpavelb dbobst_2572.c5_usa.wi.wausau2012icfjunioru23canoeslalomworlds.sfusa.k1wjunior.b01.foxjessicab dbobst_2604.c5_apwwc.usa.wi.wausau2012icfjunioru23canoeslalomworlds.sfcan.c1w.jungrevealieshab dbobst_2723_atowest2010.dwsh.hikingthehighlinetrailwithinglaciernationalparkb dbobst_2832_wrr.besten.usa.wi.whitelake.sunsetoverwolfriverrefugefromwolfriverrefugeaccessroadb dbobst_2864c3_mmaofo.usa.wi.madison.lakemendotafromobservatorydranduwmmemorialunion.perfectdayforsailingwindsurfingb dbobst_2911_mmjr.usa.wi.madison.jenniferresidence.belovedfamilycatssassyandwinterobstb dbobst_2972_usa.wi.langlade.wolfriver.s3.liquidiceflowingdownriverb dbobst_2978_usa.wi.langlade.wolfriver.s2.liquidiceflowingdownsherryrapidsb dbobst_3024_ob2012.mmao.usa.wi.olbrichbotanicalgardens.bloomingbutterflies.spicebushswallowtailb dbobst_3080_usa.wi.madison.crosscountryskiing.uwmadisonarboretum.winterwonderlandb dbobst_3091_ob2012.mmao.usa.wi.uwmarboretum.blueskiesovershallowpondb dbobst_3113_usa.wi.middleton.crosscountryskierchasingredsettingsun.governornelsonspb dbobst_3217_liab.wrr.ben.wi.langlade.nearlyautumncloudswoodscornfieldharvestb dbobst_3379_ob2014.mmao.usa.wi.uwmarboretum.ccskiersview.lastevelightoverwingrawoodsnearbigspringb dbobst_3415c_mmajr.usa.wi.middleton.funnyhumerouscatwinterplayingwithwindowblindpullstringb dbobst_3506_ob2012.mmao.usa.wi.madison.nhl.autumncolorblueskiesframestatewicapitolb dbobst_3575_mmao.usa.wi.crossplains.resplendentautumncolorsencirclefishermanonindianlakeinindianlakecpb dbobst_3677_liab.usa.wi.polar.blueskyautumnreflectionsovermuellerlakeb dbobst_3707.c3_apwwc.usa.wi.wausau2012icfjunioru23canoeslalomworlds.faus.k1junior.g0910.b35.watkins.danielb dbobst_3798_lsct.usa.wi.southrange.autumnwoodsframeamniconfallswithinafspb dbobst_4332_mmoutingso.usa.wi.middleton.bishopsbay.runwalk.oakstoweroverlakemendotaatsunsetb dbobst_4344.c7_apwwc.usa.wi.wausau2012icfjunioru23canoeslalomworlds.fsvk.c1u23.g10.b11.gajarskypatrikb dbobst_4345.c3_apwwc.usa.wi.wausau2012icfjunioru23canoeslalomworlds.fsvk.c1u23.g10.b11.gajarskypatrikb dbobst_4378_mmoutingso.usa.wi.middleton.governornelsonsp.crosscountrysking.viewacrosslakemendotaandsnowgeeseb dbobst_4466c_mmoo.usa.wi.middleton.governornelsonsp.ccsking.viewacrosslakemendotaofsnowgeeseandwicapitolb dbobst_4515_mmoutingso.usa.wi.waunakee.governornelsonsp.crosscountryskiersview.woodlandtrailoakb dbobst_4694_usa.wi.bayfield.apostleislandsnl.flowingiciclesguardicecaveb dbobst_4723_usa.wi.bayfield.apostleislandsnl.iciclesdrapeoverundercutcliffsb dbobst_4727_liss.usa.wi.tomahawk.autumncrimsonsunsetthroughstormandfogoverwiriverb dbobst_4803_usa.wi.bayfield.apostleislandsnl.blueskiesovericeiceandsnowencrustedcliffsb dbobst_4819_usa.wi.bayfield.apostleislandsnl.frostedrootbeericiclesonsandstonecliffsb dbobst_4823_usa.wi.bayfield.apostleislandsnl.frostedrootbeeric dbobst_4823_usa.wi.bayfield.apostleislandsnl.frostedrootbeericiclesonsandstonecliffsb dbobst_4953_wrroccski.usa.wi.whitelake.wolfriver.s2.skierssunnyclearskyviewoficesnowcoveredsherryrapidsb dbobst_4982_usa.wi.southrange.amniconfallssp.gorgeousdeeppowdersnowoveramniconrivervalleyb dbobst_5003_usa.wi.southrange.amniconfallssp.deeppowdersnowoveramnicorivercascadesb dbobst_5054_ob2012.mmao.usa.wi.olbrichbotanicalgardens.juliabutterflyb dbobst_5071_ob2012.mmao.usa.wi.olbrichbotanicalgardens.zebrabutterflyb dbobst_5099.02_ob2012.mmao.usa.wi.olbrichbotanicalgardens.juliabutterflyb dbobst_5159_ob2012.mmao.usa.wi.olbrichbotanicalgardens.outside.mico.waspsinvegetablegardensb dbobst_5249_wrrock.usa.wi.whitelakewolfriver.s3_blastingthroughwavesofgilmoresmistakerapidsoc1b dbobst_5263_wrrock.usa.wi.whitelakewolfriver.sec3_ocwthroughmeatofgilmoresmistakerapidsat1400cfsb dbobst_5264_wrrock.usa.wi.whitelakewolfriver.s3_precariouscounterleanoncurleringilmoresmistakerapidsocw1b dbobst_5273_wrrock.usa.wi.whitelakewolfriver.s3_oc1wblastingwavesofgilmoresmistakerapidsb pincushionmountaintrails.blueskiesoverlakesuperiorb dbobst_5401_mmjr.usa.wi.madison.scaryspideroverjenniferresidencefrontdooratnightb dbobst_5448_limoonset.wrr.ben.usa.wi.langlade.moonsetoverwolfriverrefugeb dbobst_5452_limoonset.wrr.ben.usa.wi.langlade.moonsetoverwolfriverrefugeb dbobst_5528_usa.wi.bayfield.apostleislandsnl.blueskiesandiciclesframingsandstonecavemouthb dbobst_5570_usa.wi.bayfield.apostleislandsnl.blueskiesframingvibrantsculptedsandstonecliffb dbobst_5829_wrrfl.usa.wi.langlade.acrobaticwinterthecatmothhunting.wolfriverrefugeb dbobst_5844_wrrben.usa.wi.langlade.wolfriverrefuge.viewfromwrrovericywolfriveru dbobst_5942_matrorp.p1.usa.wy.moose.grandtetonnp.autumnbeautyembracestetonmountainsb dbobst_5946_nemm.wrr.ben.honeybeeonflowerbywolfriverwithinwolfriverrefugeb dbobst_5949_matrorp.p1.usa.wy.moose.grandtetonnp.hikersautumnbeautyviewswofjennylakeb dbobst_6030_matrorp.p1.usa.wy.moose.grandtetonnp.signalmountaincampground.muledeerb dbobst_6031_dwhiking.usa.wi.mmo.baraboo.dlsp.devilslake.boulderclliffsandblueskiesframedevilslakeandclimberb dbobst_6031c_dwhiking.usa.wi.mmo.baraboo.dlsp.devilslake.collageofimagesofdevilslakestateparkonagorgeousspringday dbobst_6137_matrorp.p1.usa.wy.moose.grandtetonnp.deadmansbartomoosesection.canoeistsviewb dbobst_6163_matrorp.p1.usa.wy.moose.grandtetonnp.deadmansbartomoosesection.riverrunnersmountainviewsb dbobst_6183_matrorp.p1.usa.wy.moose.grandtetonnp.deadmansbartomoosesection.autumnviewfromsnakeriveroverlookb dbobst_6195_ob2012.mmao.usa.wi.olbrichbotanicalgardens.thaipavilion.reflectingpoolb dbobst_6240_ob2012.mmao.usa.wi.madison.nhl.statewicapitolunderblueskiesb2 dbobst_6297_wrrocanoekayak.usa.wi.whitelake.wolfriver.beautifulbroodingskiesoversectionthreeb dbobst_6333_mat.rorp.p4wrrock.usa.wi.langlade.wolfriver.s2.autumncolorsframeupperwolfriverninemilerapidslastpitchb dbobst_6334_liss.usa.wi.polar.blueskyautumncolourencirclemuellerlakeb dbobst_6350_wrrocanoekayak.usa.wi.whitelake.wolfriver.gilmoresmistake.expertcanoeistcharliefriskbacksurfingb dbobst_6373_mat.rorp.p4.usa.wi.mellen.copperfallsstatepark.autumncolorsalongbadriverabovecopperfallsb dbobst_6437_mat.rorp.p4.usa.wi.mellen.copperfallsstatepark.eveninglightoverloonlakeb dbobst_6440_wrrben.usa.wi.langlade.wolfriverrefuge.viewneastfromwrrporch.americanblackbearb dbobst_6450_wrrben.usa.wi.langlade.wolfriverrefuge.vieweastfromwrr.americanblackbearb dbobst_6579_ato.westusacanada2014usa.wyoming.jackson.bridgertetonnf.ruggedterrainalongwindriverb dbobst_6601_ato.westusacanada2014usa.wyoming.jackson.grandtetonnp.wildflowersframesnowymountainsb dbobst_6608_ato.westusacanada2014usa.wy.jackson.grandtetonnp.amreflectionsoverstringlakeb dsc_6716cb dbobst_6760.1_mmaobbcc.usa.wi.middleton.bishopsbay.runwalk.viewacrosslakemendotatowicapitalmadisonb dbobst_7393_mmoutingso.usa.wi.middleton.governornelsonsp.crosscountryskierview.sunsetoverintricateoakbranchesb dbobst_7407_mmao.usa.wi.madison.ccskiersview.winterevesunclearskiesoverowenconservationparkoaksb dbobst_7473_mmao.usa.wi.waunakee.gnsp.ccskiershikersview.sunriseoverfrozenlakemendotab dbobst_7479_mmaognsp.usa.wi.waunakee.governornelsonsp.viewacrossfrozenlakemendotaduringwintersunriseb dbobst_7510_mmaognsp.usa.wi.waunakee.governornelsonsp.crosscountryskiersview.fallingblowingsnowatduskb dbobst_7539_ato.westusacanada2014can.ab.sunshinevillage.banffnp.sunshinemeadows.rockislelakeb dbobst_7553_ato.westusacanada2014can.ab.sunshinevillage.banffnp.sunshinemeadows.reflectionsoverrockislelakeb dbobst_7573_ato.westusacanada2014can.ab.sunshinevillage.banffnp.sunshinemeadows.gardenpathtrail.simpsonviewpointb dbobst_7574_wrroutingsck.usa.wi.langlade.wolfriver.s3.20dayrapids.oc1.friskcharlesb dbobst_7582_wrroutingsck.usa.wi.langlade.wolfriver.s3.20dayrapids.oc1.friskcharlesb dbobst_7597_wrroutingsck.usa.wi.langlade.wolfriver.s3.between20dayandboyscoutrapids.ospreyb dbobst_7601_ato.westusacanada2014can.ab.sunshinevillage.banffnp.sunshinemeadows.rockislelakegrizzlylakeb dbobst_7612_ato.westusacanada2014can.ab.banff.banffnp.banffgondolatosulphurmountain.reflections.arob dbobst_7641_ato.westusacanada2014can.ab.banff.banffnp.viewfromsulphurmountainofmountainsnorthb dbobst_7649_ato.westusacanada2014can.ab.banff.banffnp.viewfromsulphurmountainofmtnseasttowardsbanffb dbobst_7651_wrroccski.usa.wi.townsend.nicoletnf.jonesspringsarea.northloopbetweenfannylakeandsawyerlrab dbobst_7656_wrroutingsck.usa.wi.langlade.wolfriver.s3.gilmoresmistakerapids.oc1.friskcharlesb dbobst_7661_ato.westusacanada2014can.ab.banff.banffnp.viewfromsulphurmountainofmountainssouthb dbobst_7709_wrrocc.usa.wi.langlade.wolfriver.s2.betweencedarandsherryrapids.brilliantblueskiesoverwinterwonderlandb dbobst_7730_ato.westusacanada2014can.ab.banff.banffnp.fairmontbanffspringshotel.viewfromoutsideterracerestaurantb dbobst_7743_mmoutingso.usa.wi.waunakee.governornelsonsp.crosscountryskiingmorningsidetrailb dbobst_7798_ato.westusacanada2014can.ab.banff.banffnp. johnstoncanyon.tortuousverdureb dbobst_7821_mmaoccs.usa.wi.crossplains.indianlakecp.ccskiersviewpmsunoverdeephardwoodforestsb dbobst_7848_ato.westusacanada2014can.ab.banff.banffnp. johnstoncanyon.rainbowoverupperfallsb dbobst_78562_ato.westusacanada2014can.ab.banff.banffnp. johnstoncanyon.rainbowoverupperfallsb dbobst_7863_ato.westusacanada2014can.ab.banff.banffnp. johnstoncanyon.180degreescanyonb dbobst_7904_ob2013.mmao.usa.wi.uwmarboretum.ccskiersview.lakewingratributarynearbigspringb dbobst_7982_ato2011ak04skagwayaktoglacierbayak.usa.ak.skagway.willowgrouseandyoungbyklondikehwybetweenfraserandskagwayb dbobst_8036_usa.mi.bessemer_ato.lsct.blackriverrabackcountryskiersviewfrozengorgefallsb dbobst_8081_ato.westusacanada2014can.alberta.jasper.jaspernp.malignecanyon.colorfullimestonegorgeb dsc_8081.nef dbobst_8093_usa.mi.bessemer_ato.lsct.blackriverrabcskiersview.frozenpotowatomifallsb dbobst_8101_ato.westusacanada2014can.alberta.jasper.jaspernp.malignecanyon.sculptedlimestonecliffsb dbobst_8176_ato.westusacanada2014can.alberta.jasper.jaspernp.malignecanyon.limestonewallsembracewaterfallb dbobst_8191_neaw.ak04.skagwayaktoglacierbayak.usa.ak.gustavus.johnhopkinsinlet.turquoisewatersblueskiesovermountains.eaglewhalessealb dbobst_8197_ato.westusacanada2014can.alberta.jasper.jaspernp.athabascafallsandgorge.hikersviewb dbobst_8232_ato.westusacanada2014can.alberta.jasper.jaspernp.athabascafalls.rainbowoverfallsb dbobst_8258_mmao.usa.wi.madison.uwmarboretum.ccskiersview.sunsetoverhardwoodsb dbobst_8268_lisals.ak04.skagwayaktoglacierbayak.usa.ak.gustavus.johnhopkinsinletandtopekaglacierb dbobst_8283_ato.westusacanada2014can.alberta.saskatchewanrivercrossing.banffnp.parkersridgetrail.hikersviewb dbobst_8284_mmao.usa.wi.madison.ocp.ccskiersview.snowshoerspassinggorgeousoakb dbobst_8295_ato.westusacanada2014can.alberta.saskatchewanrivercrossing.banffnp.parkersridgetrail.hikersviewsaskatchewanglacierb dbobst_8311_ato.westusacanada2014can.alberta.saskatchewanrivercrossing.banffnp.parkersridgetrail.saskatchewanglacierb dbobst_8343_mmao.usa.wi.waunakee.gnsp.ccskiersview.lateafternoonsunoverwindrippledsnowfieldsb dbobst_8346_mmao.usa.wi.waunakee.gnsp.ccskiersview.lateafternoonsunoverwindrippledsnowfieldsb dbobst_8376_can.bc.field.ato.westusacanada2014yohonationalpark.canoesonemeraldlakeb dbobst_8380_ato.westusacanada2014can.bc.field.yohonationalpark.canadianrockies.emeraldlake.canoesb dbobst_8417_mmajr.usa.wi.middleton.icysnowmeltofffarmlandsfeedingrivuletduringearlyspringb dbobst_8422_ato.westusacanada2014can.ab.lakelouise.banffnationalpark.canadianrockies.canoeonlakelouiseb dbobst_8434_ato.westusacanada2014can.ab.lakelouise.banffnationalpark.canadianrockies.climbersscalingcliffsnearlakelouiseb dbobst_8448_ak04.skagwayaktoglacierbayak.usa.ak.gustavus.glaciernpap.glacierbay.margerieglacierontarrinletb dbobst_8450_ato.westusacanada2014can.ab.lakelouise.banffnationalpark.canadianrockies.canoeonwestendoflakelouiseb dbobst_8455_limrms.mmoffo.usa.wi.middleton.vernalequinoxmoonrisingoverlakemendotaandwistatecapitolb dbobst_8466_ato.westusacanada2014can.ab.lakelouise.banffnationalpark.canadianrockies.canoeistsonwestendoflakelouiseb dbobst_8471_ato.westusacanada2014can.ab.lakelouise.banffnationalpark.canadianrockies.horsebackridersonwestendoflakelouiseb dbobst_8556_usa.wi.mmao.widells.mtolympus.zeus.arob dbobst_8584_usa.wi.langlade.wrr.skytornadoconditionsoverwolfriverterritoryb dbobst_8757_ak07sewardaktoanchoragedenaliparkak.gorgeoussewardsmallboatharborb dbobst_8816_nebirds.ak07sewardaktoanchoragedenaliparkak.resurrectionbaycliffboundshoresnearseward.puffinsb dbobst_8817_usa.wi.mmo.baraboo.dlsp.hikersviewpmsunhighlightingicecovereddevilslakeandbluffs.westblufftrailb dbobst_8843_usa.wi.mmo.baraboo.dlsp.blueskiesandpinesframeboulderslopes.balancedrocktrailhikersviewb dbobst_8887_usa.wi.mmo.baraboo.dlsp.goldenraysofsunsetovericecovereddevilslakeandbluffs.balancedrocktrailhikersviewb dbobst_8913_apcwolfmantriathlon.usa.wi.langlade.wolfriver.s2.canoekayakcompetitorsinsherryrapids.kayakerb dbobst_8926_usa.wi.mmo.baraboo.dlsp.sunlightslastredraysovericecovereddevilslakeandswampedpicnictable.southshoreb dbobst_9058_mmao.usa.wi.uwmarboretum.magnoliastellataorwaterlilystarmagnoliabloomsencirclehikerb dbobst_9078_lim.ak08denaliparkaktochenahotspringsak.denalinp.mountmckinleyfromdenalipkrd.snowymountmckinleyb dbobst_9135_dwnpmf.ato2011.ak08denaliparkaktochenahotspringsak.denalinp.denalipkrd.reflectionsofdenaliinwonderlakeb dbobst_9230_apcwolfmantriathlon.usa.wi.langlade.wolfriver.s2.canoekayakcompetitorsinsherryrapids.kayakersb dbobst_9275_ak09chenahotspringsaktomccarthyak.ato2011.usa.ak.wrangellsteliasnationalpark.willowlakefireweedb dbobst_9306_mmao.usa.wi.crossplains.springhardwoodscrowntrailsatindianlakestatepark.cehtrainingformtkilimanjarob dbobst_9431_usa.wi.whitelakefireworksoverwhitelake.celebratingindependencedayintheusab dbobst_9478_apcwolfmantriathlon.usa.wi.langlade.wolfriver.s2.canoekayakcompetitorsinsherryrapids.kayakerb dbobst_9570_apcwolfmantriathlon.usa.wi.langlade.wolfriver.s2.canoekayakcompetitorsinsherryrapidstandemopencanoemixedb dbobst_9603_liss.usa.ak12homeraktohotelalyeskagirdwoodak.kachemakbaysp.rosesunriseovergrewingkglacierandkenaimtnsb dbobst_9620_apcwolfmantriathlon.usa.wi.langlade.wolfriver.s2.canoekayakcompetitorsinsherryrapidstandemkayakmensteamb dbobst_9711_apcwolfmantriathlon.usa.wi.langlade.wolfriver.s2.canoekayakcompetitorsinsherryrapidstandemkayakwomensteamb dbobst_9715_apcwolfmantriathlon.usa.wi.langlade.wolfriver.s2.canoekayakcompetitorsinsherryrapidstandemkayakwomensteamb dbobst_9718_apcwolfmantriathlon.usa.wi.langlade.wolfriver.s2.canoekayakcompetitorsinsherryrapidstandemkayakwomensteamb dbobst_9805_ato2011.usa.akak12homeraktohotelalyeskagirdwoodak.neam.akreindeeralongtrailinalaskawildlifeccb dbobst_9899_apcwolfmantriathlon.usa.wi.langlade.wolfriver.s2.canoekayakcompetitorsinsherryrapidstandemkayaksplashb dbobst_9913_apcwolfmantriathlon.usa.wi.langlade.wolfriver.s2.canoekayakcompetitorsinsherryrapidstandemkayaksplashb dbobst_9922_liss.wrrrargpobst.usa.wi.mountain.wrr.relatives.orangesunsetovermaidenlakecountryclubb dbobst_9943_neaw.wrrbemusa.wi.langlade.wrr.honeybeeonflowerbywolfriverrefugeb dbobst_9946_neaw.wrrbemusa.wi.langlade.wrr.honeybeeonflowerbywolfriverrefugeb dbobst_9988_neaw.wrrbemusa.wi.langlade.wrr.honeybeeonflowerbywolfriverrefugeb dbobstcollage_77197688c_ato.westusacanada2014can.ab.banff.banffnp.fairmontbanffspringshotel.banffshireclubb dbobstcollage_89139292971899139570c_apcwolfmantriathlon.usa.wi.langlade.wolfriver.s2.canoekayakcompetitorsinsherryrapids.kayakerbc dbobstcollage_9622891390649478957297189913c_apc wolfmantriathlon.usa.wi.langlade.wolfriver.s2.canoekayakcompetitorsinsherryrapids.kayakerbc fabienb dbocollage_783078397812c_ato.westusacanada2014can.ab.banff.banffnp. johnstoncanyon.rainbowoverupperfallsb dbocollage_dsc_768877427728774977527743c_ato.westusacanada2014can.ab.banff.banffnp.fairmontbanffspringshotel.historicarchitectureb dead horse point state park deadwood river deadwood river canyon decked solo c1 decked solo canoe decked tandem canoeists colleen hayes and robert obst paddling granite rapids at mile ninetythree 93.5 of the colorado river within grand canyon national park usa az grand canyon deckedcanoeb deckedcanoesolo deep snow defending the goal maysa magic wolfpack vs. verona united soccer at redden soccer park usa wi verona delicate and lacy 84 feet or 26 meters high gibbon falls on the gibbon river within yellowstone national park delta junction in the delta river valley delta river valley near donnelly denali national park denali national park and preserve denali park road denali park road wildlife denali state park descent destiinations wild scenic hiking destiinations wild scenic hiking images by robert a. obst destination rivers wild destination wild hiking destination wild scenic hiking destination wild scenic national parks and monuments and forests destination wild scenic river valleys destination wild scenic rivers and creeks and lakes destinations destinations rivers wild destinations rivers wild adventures paddlesport canoe kayak raft expedition whitewater usa az grand canyon destinations rivers wild adventures travel usa wi nicolet national forest peshtigo river roaring rapids horserace rapids destinations rivers wild adventures travel usa wi silver cliff nicolet national forest peshtigo river roaring rapids first drop destinations rivers wild adventures travel usa wi silver cliff nicolet national forest peshtigo river roaring rapids horserace rapids destinations wild destinations wild canada destinations wild hiking destinations wild hiking orphan lake trail destinations wild hiking tapeats creek to deer creek trail destinations wild hiking trails destinations wild hking destinations wild national forests parks monuments destinations wild national parks destinations wild national parks adventures travel western usa montana mt glacier national park gnp destinations wild national parks adventures travel western usa wyoming yellowstone national park grand loop road destinations wild national parks and monuments destinations wild national parks monuments forests destinations wild national parks mounuments destinations wild national parks western usa montana mt glacier national park gnp northeast destinations wild river destinations wild rivers destinations wild scenic destinations wild scenic apostle islands national lakeshore destinations wild scenic bryce canyon national park hiking destinations wild scenic canyons destinations wild scenic cross country skiing and snowshoeing trails destinations wild scenic dws apostle islands national lakeshore destinations wild scenic hiking destinations wild scenic hiking images by robert a. obst destinations wild scenic hiking trail destinations wild scenic hiking trails destinations wild scenic hiking trails at httpwww.robertarthurobstphotos.comdestinationswildscenicdestinationswildhiking destinations wild scenic hiking trails canada kootenay national park radium hot springs british columbia marble canyon tokumm creek destinations wild scenic hiking trails siyeh pass trail destinations wild scenic lake superior circle tours destinations wild scenic national parks destinations wild scenic national parks and forests and monuments destinations wild scenic national parks and monuments destinations wild scenic national parks and monuments and forest destinations wild scenic national parks and monuments and forests destinations wild scenic national parks and monuments and forests apostle islands national lakeshore destinations wild scenic national parks and monuments at httpwww.robertarthurobstphotos.comdestinationswildscenicdwsnationalparksmonumentsfor destinations wild scenic national parks and monuments banff national park destinations wild scenic national parks and monuments banff national park waputik mountains mount sarbach mistaya river canyon destinations wild scenic national parks and monuments banff national park waputik mountains mount sarbach mistaya river valley destinations wild scenic national parks and monuments canada destinations wild scenic national parks and monuments images by robert a. obst destinations wild scenic national parks and monuments jasper national park destinations wild scenic national parks and mounuments and forests destinations wild scenic national parks monuments destinations wild scenic national parks monumnets forests destinations wild scenic river valley image 0016 destinations wild scenic rivers destinations wild scenic rivers and creeks and lakes destinations wild scenic rivers and lakes and creeks destinations wild scenic rivers creeks lakes destinations wild scenic skiing and snowshoeing destinations wild scenic skiing and snowshoeing trails destinations wild scenic state and provencial park destinations wild scenic state and provencial parks destinations wild scenic state and provenncial parks destinations wild scenic state and provincial parks destinations wild scenic state park destinations wild scenic state parks destinations wild scenic state parks and forests destinations wild scenic state provincial parks destinations wild scenic usa alaska destinations wild senic hiking destinations wild state and provencial parks destinations wild state and provincial parks destinations wild state park destinations wild state parks destinations wild state provencial parks destinations wild state provincial parks destinationswildscenic detinations wild rivers detinations wild scenic rivers deu augsberg1985 06_2010612651 apc worldc c1 hearnfordlugbillu deu augsberg1985 06_2010612721 apc worldc c1 wchearndavidb devil's lake state park images from fav or favorite obst fami devil's lake state park images from fav or favorite obst family outings within sixty miles or 60 mi or about an hour drive of the madison and middleton areas within southern wisconsin usa devils devils creek rapids devils lake south shore trail autumn woods devils lake sp hiking north end of east bluff trail devils lake sp hiking the balanced rock trail autumn view east devils lake state park devils lake state park autumn beauty devils lake state park baraboo wi usa devils lake state park hiking along the south shore autumn view east devils lake state park hiking west bluff trail autumn view east of an eagle devils lake state park hiking west bluff trail autumn view northeast dewdrops on reddish orange tiger lily or wood lily in my garden usa wi middleton dfatbdfp_8757c_ak07sewardaktoanchoragedenaliparkak.gorgeoussewardsmallboatharborb dftravelo.ato2011.usa.ak_7592 _ato2011ak3juneauaktoskagwayak.cruiseshipsgastineauchannelatportofjuneaub diamonds of sunlight and crimson autumn foliage embrace sparkling sherry rapids along the wild wolf river usa wi white lake diamonds of sunlight and crimson autumn foliage embraces sparkling sherry rapids along the wild wolf river usa wi white lake digital fun all time best of daily favorite photos by bob obst digital grin digital wonders personal favorite photos of bob obst digitalgrin diners will enjoy amazing views from the fairmont banff springs hotel within banff national park and the canadian rocky mountain parks world heritage site diners' will enjoy gorgeous views in all directions from the outside terracerestaurant at the fairmont banff springs hotel within banff alberta canada and banff national park and the canadian rocky mountains directed by the university of wisconsin madison hoofers outing club slalom chairperson robert arthur obst disclaimer original image was converted from film to digital with only fair results due to a low quality scanner discretion is the better part of valor uw wisconsin hoofers alumni kayakers portaging the granite lined and impassible big falls within class 3 to 4 south fork of the payette river canyon dishwashing line at badger camp mile eight 8 along the colorado river below lees ferry within grand canyon national park usa az grand canyon dobst_1011_wrroh.usa.wi.keshena.autumncolorsoverbigsmokeyfallswildwolfriverb don't blink eye to eye with bull elk by trail ridge road us hwy 34 in gore range of rocky mountain national park usa co estes park 80517 don't fall in beautiful and gorgeous avalanche creek gorge filled with foam and hazards near the avalanche creek trail within glacier national park don't fall in verdant avalanche creek gorge filled with foam near the avalanche creek trail within glacier national park dordogne river france double rainbow douglas island downriver oc1 cm open bib no 159 matthew dregne of the usa downriver oc1 cm open bib no 159 matthew dregne of the usa action at the 2016 aca open canoe usa slalom nationals north american championships 22 24 july 2016 usa wi wausau downriver oc1 cm open bib no 159 matthew dregne of the usa and downriver oc1 cm open bib no 159 matthew dregne of the usa and bib no 174 alan smith of st. paul mn usa action at the 2016 aca open canoe usa slalom nationals north american championships 22 24 july 2016 usa wi wausau downriver oc1 cm open bib no 174 alan smith of st. paul mn usa action at the 2016 aca open canoe usa slalom nationals north american championships 22 24 july 2016 usa wi wausau dr. howard baer of the university of wisconsin hoofers outing club plunging his solo decked canoe over a waterfall within the linville gorge wilderness area or grand canyon of north carolina during may of 1984 usa nc spruce pine dragon fly on daffodil or narcissus flowers by the wild wolf river within the wolf river refuge usa wi white lake dragon fly on phlox flowers by the wild wolf river within the wolf river refuge usa wi white lake dragonfly of the order odonata and the suborder epiprocta or the infraorder anisoptera dramatic frank lloyd wright inspired monona terrace at night driftwood bay state marine park driftwood bay state marine park of alaska usa drop shadow dry washes and grasslands frame denali or mount mckinley from denali park road within denali national parkusa alaska denali park dsc7612 dsc7697 dsc_ 5146.nef dsc_ 5160.nef dsc_ 5210.nef dsc_ 5551.nef dsc_ 5559.nef dsc_ 6831.nef dsc_ 6859.nef dsc_ 6865.nef dsc_ 6964.nef dsc_ 7555.nef dsc_0018.nef dsc_0024.nef dsc_0037.nef dsc_0038.nef dsc_0047.nef dsc_0053.nef dsc_0062.nef dsc_0078.nef dsc_0078072502370079062607550535053605290550.nef dsc_0078collagewithtext dsc_0079.nef dsc_0079039705500078023705350024.nef dsc_0079collagewithtext dsc_0083.nef dsc_0084.nef dsc_0090.nef dsc_0091.nef dsc_0097.nef dsc_0098.nef dsc_0104.nef dsc_0735.nef dsc_4823.nef dsc_5096.nef dsc_5949.nef dsc_6061.nef dsc_6069.nef dsc_6695.nef dsc_6716.nef dsc_6902.nef dsc_7526.nef dsc_7531.nef dsc_7539.nef dsc_7549.nef dsc_7553.nef dsc_7564.nef dsc_7566.nef dsc_7567.nef dsc_7572.nef dsc_7573.nef dsc_7590.nef dsc_7593.nef dsc_7595.nef dsc_7599.nef dsc_7603.nef dsc_7608.nef dsc_7638.nef dsc_7655.nef dsc_7656.nef dsc_7719.nef dsc_7730.nef dsc_7796.nef dsc_7804.nef dsc_8122.nef dsc_8130.nef dsc_8156.nef dsc_8188.nef dsc_8250 .nef dsc_8283.nef dsc_8285.nef dsc_8286.nef dsc_8295.nef dsc_8311.nef dsc_8314.nef dsc_8368.nef dsc_9622891390649478957297189913c.nef dsc_apcwt images.nef dsc_images.nef duck confit with poached pacific halibut and wild british columbia mushrooms anyone at the banffshire club restaurant of the fairmont banff springs hotel within banff alberta canada and banff national park and the canadian rocky mountain parks world heritage site dwr_1119_usa.lia.wrrben.usa.wi.lily.wolfriveratmilitaryparkb dwrivers.usa.ak_9948_ato2011ak04skagwayaktoglacierbayak.usa.ak.skagway.usnationalhl.skagwayriverandwhitepassrrb dws dwsnpmcanada.ato2010_3496_dwsriv.can.ab.banffnp.waputikmtns.mistayariverb dwsp.liss.mmao_9125_usa.wi.waunakee.orangesunriseoverlakemendotaframedbyoakatgnspb dwsrivers_8122_ato.westusacanada2014can.alberta.jasper.jaspernp.malignecanyon.canyonbelow4thbridgeb dwsrivers_8130_ato.westusacanada2014can.alberta.jasper.jaspernp.malignecanyon.rapidswithlimestonecliffsb dwsrivers_8250_ato.westusacanada2014can.alberta.jasper.jaspernp.athabascafalls.hikersviewfallsb eagles early morning moonset over the wolf river refuge and the wild wolf river usa wi langlade east bluff view north east gnp near st. mary lake educationo image galleries by bob obst educationo image galleries by bob obst private sharegroup eiskanal augsburg germany enchanting eno entlen mountains of berner oberland switzerland entlen river finsterwald bei entlebuch suisse epilobium angustifolium or fireweed or great willowherb epilobium angustifolium or fireweed or great willowherb a perennial herbaceous plant in the willowherb family onagraceae native throughout the temperate northern hemisphere epilobium angustifolium or fireweed or great willowherb a perennial herbaceous plant in willowherb family onagraceae native throughout the temperate northern hemisphere epilobium angustifolium or fireweed or great willowherb is a perennial herbaceous plant in the willowherb family onagraceae which is native throughout the temperate northern hemisphere europe austria obertilliach gail river valley europe austria tyrol lienz obertilliach gail river valley evening light over oak savannas events expert open canoeist boofing sullivan falls at 744 cfs on the wild wolf river section 4 within menominee indian nation usa wi keshena expert recovery after nearly backendering a whitewater slalom solo decked canoe explorer's and bird's eye view of low afternoon sunlight over t explorer's and bird's eye view of low afternoon sunlight over the treinen farm corn maze and flagged tower fav or favorite obst family outings within sixty miles or 60 mi or about an hour drive from the cities of madison and middleton of southern wisconsin usa usa wi madison middleton area lodi extreme class 5 whitewater canoe and kayak racing during the g extreme class 5 whitewater canoe and kayak racing during the green river narrows race extreme weather eye to eye with dall sheep eye to eye with dall sheep near denali park road and polychrome pass within denali national park usa alaska denali park eyetoeye with a friendly mule deer grazing outside my tent in my signal mountain campsite on jackson lake within grand teton national park fairmont banff springs hotel luxury hotel was built during the 19th century or 1888 as one of canada's grand railway hotels fairmont banff springs hotel was built in 1888 and its core was rebuilt in 1928 in the scottish baronial architectural style by founder william cornelius van horne and original hotel architect bruce price and present hotel core architect walter s. painter falls family gatherings and outings sharegroup fascinating rock along the tapeats river to thunder river hike near the colorado river within grand canyon national park usa az grand canyon fav fav or favorite obst family outings within sixty miles or 60 mi fav or favorite obst family outings within sixty miles or 60 mi or about an hour drive from the cities of madison and middleton of southern wisconsin usa favorite alaska photos favorite alaskan photos favorite outings canoe kayak wolf river section 3 favorite outings wolf river section 1 highway 52 at lily to wolf road short section 1 favorite outings wolf river section one highway 52 at lily to wolf road short section 1 favorite outings wolf river section one highway 52 at lily to wolf road short section one favorite photos by bob obst fears of sea kayaking felis catus or felis silvestris catus ferry blluff state natural area of the lower wisconsin state riverway or wisconsin river valley images from fav or favorite obst family outings within sixty miles or 60 mi or about an hour drive of the madison and middleton areas within southern wisconsin usa firehole river to madison river to missouri river to mississippi river to gulf of mexico atlantic ocean fireweed fireweed and willow lake and gorgeous evening light frames mount drum and mount wrangell within wrangellst. elias national park and preserve usa alaska copper center fireweed or epilobium angustifolium or great willowherb fireweed trail hiker's view of fireweed growing along tokumm creek within marble canyon of kootenay national park canada bc radium hot springs fireweed trail hiker's view of fireweed growing near tokumm creek and marble canyon within kootenay national park canada bc radium hot springs fireweed trail hiker's view of waterfall on tokumm creek within marble canyon of kootenay national park canada bc radium hot springs fireweed trail youth hiker skipping stones over turquoise tokumm creek within marble canyon of kootenay national park canada bc radium hot springs fireworks fireworks extraordinaire flaming leaves and pink quartzite boulder fields under cerulean skies dominate autumn views off balanced rock trail within devils lake state park flightseeing or float plane tour of misty fiords national monument flowering apple tree rosy blooms explode over a wild turkey within longenecker gardens of the university of wisconsin madison arboretum usa wi madison flowering apple tree rosy blooms within longenecker gardens of the university of wisconsin madison arboretum usa wi madison flowers of wisconsin flowersandmoreflowers following a path from the past view from the historical richardson highway or alaska highway 4 of moose grazing in backwaters of delta river valley near donnelly between fairbanks and paxson usa alaska donnelly following a path from the past view from the historical richardson highway or alaska highway 4 of moose grazing in backwaters of the delta river valley near donnelly between fairbanks and paxson usa alaska donnelly following in the path of ansel adams who captured his famous image from this same location of the teton range from the snake river overlook wyoming usa foot of mendenhall glacier at mendenhall lake four hundred and ninety two feet high bird woman falls along goingtothesun road within glacier national park four wheel drive vehicle rider's view during their 'arctic adventures glacier ride' adventure of the rugged landscapes bordering the kerlingafjöll mountain range within the icelandic highlands and the arnarvatnsheidi kjolur area of western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 4 august 2015 fourth of july 2013 fireworks over white lake wisconsin within the wolf river territory fourth of july 2013 fireworks over white lake wisconsin within the wolf river territory usa wi white lake fourth of july 2013 fireworks viewing over white lake wisconsin fourth of july celebrations small town usa fresh snow and autumn colors frame walker camp prong of the west prong of the little pigeon river near us highway 441 or newfound gap road and the alum cave trailhead within great smoky mountains national park usa nc tn gatlinburg fresh snow and autumn colors highlight the forested mountains near us highway 441 or newfound gap road and thomas ridge within great smoky mountains national park usa nc tn gatlinburg fresh snow and autumn folliage frame cascading walker camp prong of the west prong of the little pigeon river near us highway 441 or newfound gap road and the alum cave trailhead within great smoky mountains national park usa nc tn gatlinburg full moon rose over usa wisconsin madison middleton lake mendota at 639 pm full supermoon sunrise begins at 639 pm over the pheasant branch creek conservany and the lake mendota waterfront near captain bills restaurant within middleton wi usa fav or favorite obst family outings within southern wisconsin usa usa wi madison middleton funter bay state marine park gail river austria gailrivervalley gardner dam scout camp gastineau channel glacial outwash and moraine images glaciated mountains and hiking trails encircle canoeists on emerald lake louise canada alberta lake louise glacier glacier bay national park and preserve glacier national park glacier national park gnp glacier national park photos glaciers god bless america going to the sun road goingtothesun goingtothesun and little chief mountains view goingtothesun mountain goingtothesun road goingtothesunroad gold medalists and world champions canoe double or c2 men team france labarelle pierrepeschier nicolas and klauss gauthierpeche matthieu and picco pierrebiso hugo final rank 1st out of 11 c2 teams final runs on 21 sept 2014 at the 2014 icf 'deep creek 'world championships at the adventure sports center international site near deep creek lake and mchenry md usa gold medalists and world champions canoe double or c2 men team france labarelle pierrepeschier nicolas and klauss gauthierpeche matthieu and picco pierrebiso hugo final rank 1st out of 11 c2 teams final runs on 21 sept 2014 at the 2014 icf 'deep creek 'world championships at the adventure sports center international site near deep creek lake and mchenry md usa usa md mchenry gold medalists and world champions kayak single women or k1w team france bouzidi carole and newman nouria and fer emilie final runs final rank 1st out of 13 k1w teams on 21 sept 2014 at the 2014 icf 'deep creek 'world championships at the adventure sports center international site near deep creek lake and mchenry md usa golden autumn glory along section 2 of the wild wolf river at sherry rapids between irrigation hole and langlade images from the best of environment and nature and outings near the wolf river refuge within the wolf river territory of northeastern wisconsin usa usa wi langlade golden cliffs golfer's and walker's view across the bishops bay golf greens and lake mendota to the state of wisconsin capital of madison usa wi middleton good morning madison wi usa gorgeous autumn foliage frames cliff top split rock lighthouse minnesota state historic site on lake superior gorgeous crimson autumn sunset afterglow highlights the woods ripples island and rocks of the wolf river gorgeous evening light gorgeous full 2012 autumnal equinox harvest moon rising over youth fisherman on the lake street dock by captain bill's waterfront near the outlet of pheasant branch creek conservany usa wi middleton gorgeous full 2013 vernal equinox early spring moon rising over lake mendota and the wisconsin state capitol of madison as observed from near the outlet of pheasant branch creek conservany usa wi middleton gorgeous magenta clematis in a flower garden by the wild wolf river within the wolf river refuge usa wi white lake gorgeous moon for the beautiful wedding of tonya rath johnson and patrick james jaskolski gorgeous morning reflections over string lake within grand teton national park gorgeous orange cleopatra foxtail lily in olbrich botanical gardens usa wi madison governor nelson state park governor nelson state park near waunakee wi usa governor nelson state park on lake mendota usa wi waunakee graduations grand canyon of north carolina grand loop road grand teton national park granite mountains encircle hanging valley lake drained by a waterfall within the rugged misty fiords national monument usa alaska ketchikan great blue heron in flight over the verdure shores of section 2 of the wild wolf river usa wi white lake great blue heron posing for take off from log along verdure shores of the wild wolf river usa wi white lake great britain canoe whitewater kayak team juniors great smoky mountains national park straddles ridge after ridge of forest along the border between north carolina and tennessee within southeastern usa. according to its web site great smoky mountains national park is 'world renowned for its diversity of plant and animal life greatest eclipse at 942 pm green river race first place finisher in an offical competition class green river race images of extreme class 5 whitewater canoe an green river race images of extreme class 5 whitewater canoe and kayak racing on pitches of gorilla rapids within the green river narrows and green river game lands near usa nc saluda green river race medalists or top three finishers in each official competition class green river race narrows canoe kayak extreme wildwater near usa green river race narrows canoe kayak extreme wildwater near usa nc saluda green river race narrows extreme wildwater 1st place finisher in c1 or solo decked canoe with a time of 0447 ben fraker bib number 17 paddling a liquidlogic stinger long c1 over class 5 gorilla the flume rapids of the green river narrows usa nc saluda green river race narrows extreme wildwater 1st place finisher in hand paddles with a time of 0517 bill clipper bib number 40 paddling a liquidlogic stinger long kayak over class 5 gorilla the flume rapids of the green river narrows usa nc saluda green river race narrows extreme wildwater 1st place finisher in hand paddles with a time of 0517 bill clipper bib number 40 paddling a liquidlogic stinger long kayak without a paddle over class 5 gorilla the flume rapids of the green river narrows usa nc saluda green river race narrows extreme wildwater 1st place finisher in oc1 or open decked solo canoe with a time of 0732 nathan zumwalt bib number o78 paddling a dagger prophet long oc1 over class 5 gorillathe flume and gorillascream machine rapids within the green river narrows usa nc saluda green river race narrows extreme wildwater 1st place finisher in women's kayak or k1w with a time of 0444 adriene levknecht bib number 22 paddling a liquidlogic stinger long kayak within class 5 gorilla the flume rapids of the green river narrows usa nc saluda green river race narrows extreme wildwater 2nd place finisher in c1 or solo decked canoe with a time of 0449 tad dennis bib number 54 paddling a dagger green boat long c1 over class 5 gorilla the flume rapids of the green river narrows usa nc saluda green river race narrows extreme wildwater 2nd place finisher in hand paddles with a time of 0531 jake trotter bib number 84 paddling a jackson karma unlimited long kayak without a paddle over class 5 gorilla the flume rapids of the green river narrows usa nc saluda green river race narrows extreme wildwater 2nd place finisher in short kayak with a time of 0510 dave fusilli bib number 115 paddling a pyranha 9r kayak and passing another kayaker within the congested class 5 gorilla the flume rapids of the green river narrows usa nc saluda green river race narrows extreme wildwater 2nd place finisher in women's kayak or k1w with a time of 0545 katie dean bib number 85 paddling a dagger green boat long kayak within class 5 gorilla the flume rapids of the green river narrows usa nc saluda green river race narrows extreme wildwater 3rd place finisher in c1 or solo decked canoe with a time of 0453 jordan poffenberger bib number 26 paddling and eskimo rolling a liquidlogic stinger long c1 over class 5 gorilla the flume rapids of the green river narrows usa nc saluda green river race narrows extreme wildwater 3rd place finisher in women's kayak or k1w with a time of 0553 mary katherine fields bib number 102 paddling a dagger green boat long kayak within class 5 gorilla the flume rapids of the green river narrows green river race narrows extreme wildwater autumn beauty surrounds kayaking trio plunging over the class 5 gorillascream machine rapids within the green river narrows usa nc saluda green river race narrows extreme wildwater george boss bib number 110 kayak competitor with a time of 0526 paddling a dagger nomad short kayak through class 5 gorillathe flume within the green river narrows usa nc saluda green river race narrows extreme wildwater jason hale bib number 21 with a time of 0451 in a liquidlogic stinger long k1 plunging sideways over class 5 gorillathe flume rapids within the green river narrows usa nc saluda green river race narrows extreme wildwater mayhem and carnage bib number 139 stephens brown in a dagger nomad kayak overtaking bib number 138 scott kelly in a jackson karma with a spectacular endoverend and eskimo rolls within the congested class 5 gorilla the flume rapids of the green river narrows usa nc saluda green river race narrows extreme wildwater mayhem and chaos sequence green river race narrows extreme wildwater mayhem chaos sequence andrew mcewan bib number 36 with a final time of 0442 airborne blasting his prijon tornado long k1 over the speed trap near the base of class 5 gorilla the flume rapids within the green river narrows usa nc saluda green river race narrows extreme wildwater mayhem chaos sequence eric chance bib number 33 with a final time of 0515 endering his prijon tornado long k1 within the speed trap near the base of class 5 gorilla the flume rapids within the green river narrows usa nc saluda green river race narrows extreme wildwater mayhem chaos sequence matt anger bib number 19 with a final time of 0447 blasting his jackson karma unlimited long k1 through the speed trap near the base of class 5 gorilla the flume rapids within the green river narrows usa nc saluda green river race narrows extreme wildwater mayhem chaos sequence paddler caught in or near the foamy chaos of the speed trap near the base of class 5 gorilla the flume rapids within the green river narrows usa nc saluda green river race narrows extreme wildwater mayhem chaos sequence sam manzer bib number 71 with a final time of 0656 and congratulations to sam for taping his boat and finishing the race paddling a prijon tornado long kayak sideways with boat damage consequences over class 5 gorilla the flume rapids within the green river narrows usa nc saluda green river race narrows extreme wildwater mayhem chaos sequence sam manzer bib number 71 with a final time of 0656 and congratulations to sam for taping his boat and finishing this race paddling a prijon tornado long kayak sideways towards the speed trap at the base of this drop with boat damage consequences through class 5 gorilla the flume rapids within the green river narrows usa nc saluda green river race narrows extreme wildwater mayhem chaos sequence wade harrison bib number 69 with a final time 0441 in a dagger green boat long k1 passing and nearly colliding within the speed trap jonas gruenewald bib number 68 with a final time of 0559 in a jackson karma unlimited long k1 of class 5 gorilla the flume rapids within the green river narrows usa nc saluda green river race narrows extreme wildwater overall 1st place finisher or tied for 1st place with a time of 0419 isaac levinson bib number 6 paddling a jackson karma unlimited long kayak through class 5 gorilla the flume within the green river narrows usa nc saluda green river race narrows extreme wildwater overall 2nd place finisher or tied for 1st place with a time of 0419 dane jackson bib number 2 paddling a jackson karma unlimited long kayak through class 5 gorilla the flume and gorilla scream machine rapids within the green river narrows usa nc saluda green river race narrows extreme wildwater overall 3rd place finisher with a time of 0423 pat keller paddling a liquidlogic stinger long kayak through class 5 gorilla the flume and gorilla scream machine rapids within the green river narrows usa nc saluda green river race narrows extreme wildwater taylor cofer bib number 59 with a time of 0456 in a dagger green boat long k1 plunging over class 5 gorillathe flume rapids within the green river narrows usa nc saluda green river race second place finisher in an offical competition class green river race third place finisher in an offical competition class grewingk glacier grosse entlen berner oberland switzerland or suisse kayaking hang on for dear life to your paddle while rafting horserace rapids hanger on the wharf hanging chaba valley and athabasca valley join where the sunwapta a native word meaning 'turbulent water' river has carved a deep limestone gorge happy hikers' view from balanced rock trail of late day sun highlighting ice covered devil's lake and the radiant bluffs and foliage within devils lake state park usa wi baraboo harry and jan's dog 'brae' within the home of harry robert house and jan hansen near the junction of the greys river and salt river and snake river within alpine wyoming major retirement adventure travel by robert arhtur obst tofrom usa wy 13 to 27 of may 2015 spring into yellowstone events including selfguided tours of yellowstone national park and grand teton national park areas and return to usa wi middleton usa wy alpine harry robert house near the confluence of the snake and grays rivers within alpine wyoming major retirement adventure travel by robert arhtur obst tofrom usa wy 13 to 27 of may 2015 spring into yellowstone events including selfguided tours of yellowstone national park and grand teton national park areas and return to usa wi middleton usa wy alpine harry robert house with a 'cowboy' and his horse within the valley of the greys rivers near alpine wyoming major retirement adventure travel by robert arhtur obst tofrom usa wy 13 to 27 of may 2015 spring into yellowstone events including selfguided tours of yellowstone national park and grand teton national park areas and return to usa wi middleton usa wy alpine harry robert house with his dog 'brae' with the bridgerteton national forest and valley of the upper greys river watershed near alpine wyoming major retirement adventure travel by robert arhtur obst tofrom usa wy 13 to 27 of may 2015 spring into yellowstone events including selfguided tours of yellowstone national park and grand teton national park areas and return to usa wi middleton usa wy alpine harry robert house with his dog on a bridge over the sparkling greys rivers near alpine wyoming major retirement adventure travel by robert arhtur obst tofrom usa wy 13 to 27 of may 2015 spring into yellowstone events including selfguided tours of yellowstone national park and grand teton national park areas and return to usa wi middleton usa wy alpine harry robert house with our tandem canoe taking a break during our salt river paddle near alpine wyoming major retirement adventure travel by robert arhtur obst tofrom usa wy 13 to 27 of may 2015 spring into yellowstone events including selfguided tours of yellowstone national park and grand teton national park areas and return to usa wi middleton usa wy alpine harvest full moon rising in black skies over woodlands and corn fields near wild wolf river usa wi white lake hattie cove hemaris thysbe or hummingbird clearwing moth of the sphingidae family heron bay hidden lake hidden lake overlook trail highlights along the seward ak to anchorage ak highway or highway hiker enjoying a dazzling view of the saskatchewan glacier and columbia icefield within the canadian rockies and banff national park and alberta canada 2014 obst family adventure travel program images of exploring the national parks of the canadian rockies within alberta and british columbia canada can alberta british columbia hiker on the parker ridge trail enjoying a dazzling view of the saskatchewan glacier and columbia icefield within the canadian rockies and banff national park and alberta canada 2014 obst family adventure travel program images of exploring the national parks of the canadian rockies within alberta and british columbia canada can alberta british columbia hiker's and bird's eye view of many mountain ranges from the top of sulphur mountain near the banff gondola skywalk and cosmic ray station national historic site of canada hiker's and motorists view from the road to clingman's dome of smoky mountains marching to the horizon within great smoky mountains national park usa nc tn gatlinburg hiker's and visitor's view of the flower and verdure framed gullfoss waterfall which plunges into a spectacular canyon on the hvita or white river within western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 4 august 2015 hiker's enjoy gorgeous autumn foliage and cliffs under moody skies along the west bluff trail within devils lake state park usa wi baraboo hiker's view hiker's view from the balanced rock and ice age trails of balanced rock and the east bluff within devil's lake state park during autumn images from fav or favorite obst family outings within sixty miles or 60 mi or about an hour drive of the madison and middleton areas within southern wisconsin usa usa wi baraboo hiker's view from the balanced rock trail of the last golden rays of a spring sunset over ice covered devils lake within devils lake state park usa wi baraboo hiker's view from the parker ridge trail of the saskatchewan glacier near the icefield's parkway within banff national park hiker's view from the top of sulphur mountain along the banff skywalk and south east ridge trail from banff alberta canada hiker's view from the trail to clingman's dome observation tower of foliage framing forested mountains rolling to the horizon within great smoky mountains national park usa nc tn gatlinburg hiker's view from the trail to clingman's dome of foliage framing forested mountains rolling to the horizon within great smoky mountains national park usa nc tn gatlinburg hiker's view from whistlers mountain top of the athabasca river valley within jasper national park can ab jasper hiker's view of a gorgeous winter sunrise over a frozen lake mendota from governor nelson state park usa wi waunakee hiker's view of a rainbow over upper johnston falls within johnston canyon of banff national park and alberta canada 2014 23 june 2014 through 13 july 2014 usa id mt obst family adventure travel images of hiking and whitewater paddling within idaho usa and hiking within montana usa and the national parks of the canadian rockies within alberta and british columbia canada by robert arthur obst usa id mt can alberta british columbia hiker's view of athabasca falls near the icefield's parkway within jasper national park hiker's view of autumn beauty along the jenny lake trail within grand teton national park hiker's view of autumn foliage framing the mountains southwest of jenny lake within grand teton national park hiker's view of autumn glory embracing the lower wisconsin state riverway by the ferry blluff state natural area images from obst family outings within sixty miles or 60 mi or about an hour drive of the madison and middleton areas near sauk city within southwestern wisconsin usa usa wi sauk city hiker's view of blue skies and trees and and quartzite boulders framing turquoise devils lake along east bluff trail within devils lake state park usa wi baraboo' hiker's view of blue skies over turquoise devils lake and quartzite boulders along east bluff trail within devils lake state park usa wi baraboo' hiker's view of clear champagne waters of johnston creek within johnston canyon and banff national park can alberta banff hiker's view of fresh snow and autumn folliage framing walker camp prong of the west prong of the little pigeon river near the alum cave trailhead and us highway 441 or newfound gap road within great smoky mountains national park usa nc tn gatlinburg hiker's view of gorgeous grizzly lake along the garden parth trail of the sunshine meadows trail system near the continental divide of the canadian rockies and the albertabritish columbia border within banff national park and alberta canada 2014 obst family adventure travel program images of exploring the national parks of the canadian rockies within alberta and british columbia canada can alberta banffsunshine meadows hiker's view of high falls within johnston canyon of banff national park and alberta canada 2014 usa id mt can ab obst family adventure travel program images of hiking and whitewater paddling within idaho usa and hiking within montana usa and the national parks of the canadian rockies within alberta and british columbia canada usa id mt can alberta british columbia hiker's view of one of the twin pools of the blesi or the blazer within the colorful geysir hot springs area of south western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 4 august 2015 hiker's view of rainbow highlighted high falls within johnston canyon of banff national park and alberta canada 2014 usa id mt can ab obst family adventure travel program images of hiking and whitewater paddling within idaho usa and hiking within montana usa and the national parks of the canadian rockies within alberta and british columbia canada 2014 usa id mt can alberta british columbia hiker's view of rock isle lake near the rock isle trailgarden parth trail junction of the sunshine meadows trail system near the continental divide of the canadian rockies and the albertabritish columbia border within banff national park and alberta canada 2014 obst family adventure travel program images of exploring the national parks of the canadian rockies within alberta and british columbia canada can alberta banffsunshine meadows hiker's view of sparkling sunlilght and fresh snowfall over a rugged ravine near the appalachian trail and us highway 441 or newfound gap road within great smoky mountains national park usa nc tn gatlinburg hiker's view of the flower framed gullfoss waterfall which plunges into a spectacular canyon on the hvita or white river within western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 4 august 2015 hiker's view of the gorgeous verdure serpentine johnston canyon within banff national park and alberta canada 2014 usa id mt obst family adventure travel program images of hiking and whitewater paddling within idaho usa and hiking within montana usa and the national parks of the canadian rockies within alberta and british columbia canada usa id mt can alberta british columbia hiker's view of the lower wisconsin state riverway from the ferry blluff state natural area images from obst family outings within sixty miles or 60 mi or about an hour drive of the madison and middleton areas near sauk city within southwestern wisconsin usa usa wi sauk city hiker's view of the rugged and steep bald ridge trail during the bald ridge trail photography tour with kathy lichtendahl on friday 15 may 2015 usa wy cody chamber of commercesponsored spring into yellowstone event starting at the hogan reservoir and campground area usa wy cody hiker's view of the saskatchewan glacier and columbia icefield within the canadian rockies and banff national park and alberta canada 2014 obst family adventure travel program images of exploring the national parks of the canadian rockies within alberta and british columbia canada can alberta british columbia hiker's view of the volcanic steam vents and badlands bordering the rugged trail between the landmannalaugar area camp and mount blahnukur within south western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 5 august 2015 hiker's view of towering mountains from simpson viewpoint along the garden parth trail of the sunshine meadows trail system near the continental divide of the canadian rockies and the albertabritish columbia border within banff national park and alberta canada 2014 obst family adventure travel program images of exploring the national parks of the canadian rockies within alberta and british columbia canada can alberta banffsunshine meadows hiker's view up sheer rock face towards the sulphur mountain cosmic ray station within banff national park and tthe canadian rocky mountain parks world heritage site hiker's view upriver under clear sapphire blue skies from the top of ferry bluff of the lower wisconsin state riverway usa wi sauk city hiker's west bluff trail view under cobalt skies of quartzite cliffs encircling devils lake within devils lake state park usa wi baraboo hikers and cliff climbers enjoy dizzying views from the top of granite mountains which plunge three or four thousand dizzying feet from snow covered tops to fiords within misty fiords national monument usa alaska ketchikan hikers approaching the athabasca glacier of the columbia icefield area within jasper national park and alberta canada 2014 23 june through 13 july usa id mt obst family adventure travel program of hiking and whitewater paddling within idaho usa and hiking within montana usa and the national parks of the canadian rockies within alberta and british columbia can by imagery creation evangelist robert arthur obst usa id mt can alberta bc hikers carefully making their way down a slippery and snowcovered trail on misty and rainy day between the landmannalaugar area camp and mount blahnukur within south western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 5 august 2015 hikers carefully making their way down a slippery trail on misty and rainy day between the landmannalaugar area camp and mount blahnukur within south western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 5 august 2015 hikers carefully making their way past a radiant mosscovered and colorful scarred volcanic mountain during a misty and rainy day between the landmannalaugar area camp and mount blahnukur within south western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 5 august 2015 hikers pass glaciers hikers view from the parker ridge trail of the canadian rockies overlooking the saskatchewan glacier near the icefield's parkway within banff national park hikers view from the parker ridge trail of the saskatchewan glacier valley near the icefield's parkway within banff national park hikers' and trail runners' view of blue skies and brilliant autumn colors during autumn within indian lake county park usa wi cross plains hikers' autumn beauty view of mountains framing phelps lake from the phelps lake trail within the laurance s. rockefeller preserve of grand teton national park hikers' view of autumn foliage beginning to turn orange along phelps lake from the phelps lake trail within the laurance s. rockefeller preserve of grand teton national park hiking hiking along the presque isle river near the north country trail and lake superior trail within porcupine mountains wilderness state park hiking along watersculpted deer creek gorges during hike from tapeats to thunder river and deer creek canyons near the colorado river within grand canyon national park usa az grand canyon hiking angels landing or the grotto trail hiking east bluff trail autumn woods magic light devils lake state park hiking highline trail on mount gould near logan pass within glacier nationalpark hiking or wander route 'kaiserhaus erzherzog johann klaus' aschau austria or österreich hiking over the sunshine meadows trail system including all of the rock island trail and the garden parth trail to gorgeous views of the canadian rockies near the continental divide and along the albertabritish columbia border within banff national park and alberta canada 2014 obst family adventure travel program images of exploring the national parks of the canadian rockies within alberta and british columbia canada can alberta banffsunshine meadows hiking stanley glacier trail through the stanley glacier hanging valley within kootenay national park hiking the 'sunwapta falls to fortress lake and hamber provincial park' trail hiking the fireweed trail in marble canyon along tokumm creek near radium hot springs british columbia hiking the gorgeous trails of governor nelson state park on lake mendota near madison wi usa hiking the hidden lake overlook trail near logan pass within glacier national park hiking the highline trail near logan pass within glacier national park hiking the highline trail on mount gould near logan pass within glacier national park hiking the maligne lake trails canada alberta jasper hiking the maligne river canyon trails hiking the maligne river canyon trails canada alberta jasper hiking the north country trail hiking the north face trail of the alyeska resort near usa alaska girdwood hiking the path of the glacier loop of mt. edith cavell trail within jasper national park hiking the southernheadlandtrail along lake superior hiking the trails of dane county's indian lake county park during autumn hiking the trails of dane county's indian lake county park during springtime hiking the west bluff trail and ice age national scenic trail hiking the west bluff trail and ice age national scenic trail within devils lake state park hiking the woodlands trails near the wolf river and wolf river refuge hiking through the johnston creek canyon within banff national park hiking through the valley of the yoho river between emerald and daly glaciers within yoho national park hiking trails encircle lake louise and lead from lake louise to saddleback pass and fairview mountain and mirror lake and lake agnes and big beehive and little beehive and devils thumb and mount whyte and mount niblock. hiking usa hiking west bluff trail cliff view north dlsp hiking with arthur robert obst over the parker ridge trail of banff national park and alberta canada 2014 23 june 2014 through 13 july 2014 usa id mt obst family adventure travel images of hiking and whitewater paddling within idaho usa and hiking within montana usa and the national parks of the canadian rockies within alberta and british columbia canada by robert arthur obst hiking with arthur robert obst over the parker ridge trail to dazzling views of the saskatchewan glacier and columbia icefield within the canadian rockies and banff national park and alberta canada 2014 obst family adventure travel program images of exploring the national parks within the canadian rockies and alberta and british columbia canada can alberta british columbia hiking with arthur robert obst over the sunshine meadows trail system within banff national park and alberta canada 2014 23 june 2014 through 13 july 2014 usa id mt obst family adventure travel images of hiking and whitewater paddling within idaho usa and hiking within montana usa and the national parks of the canadian rockies within alberta and british columbia canada by robert arthur obst hiking with arthur robert obst within johnston canyon of banff national park and alberta canada 2014 23 june 2014 through 13 july 2014 usa id mt obst family adventure travel images of hiking and whitewater paddling within idaho usa and hiking within montana usa and the national parks of the canadian rockies within alberta and british columbia canada by robert arthur obst hiking with arthur robert obst within johnston canyon of banff national park and alberta canada 2014 23 june 2014 through 13 july 2014 usa id mt obst family adventure travel images of hiking and whitewater paddling within idaho usa and hiking within montana usa and the national parks of the canadian rockies within alberta and british columbia canada by robert arthur obst usa id mt can alberta british columbia hiking with elysia noelle obst on a gorgeous springtime day within governor nelson state park on lake mendota fav or favorite obst family outings within sixty miles or 60 mi or about an hour drive from the cities of madison and middleton of southern wisconsin usa hiking within johnston canyon of banff national park and alberta canada usa id mt obst family adventure travel images of hiking and whitewater paddling within idaho usa and hiking within montana usa and the national parks of the canadian rockies within alberta and british columbia canada usa id mt can alberta british columbia hiking within the lake of the clouds scenic area near the north country trail and lake superior trail within porcupine mountains wilderness state park historical richardson highway or alaska highway 4 hofsjökull glacier and kerlingafjöll mountain range within the arnarvatnsheidi kjolur area of western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 4 august 2015 holland america zaandam holland america zaandam cruise ship land tour or shore tour holland america zaandam cruise ship shore excursion holland america zaandam passengers enjoy a spectacular orange midnight sunset within the inland passage of british columbia canada can bc inland passage vancouver holland america zaandam passengers enjoy morning light and fog over the inside passage of british columbia canada can bc inside passage vancouver holland america zaandam ship cruises through dark waters past a lonely fishing boat and a spectacular orange sunset over mountains within the inside passage between ketchikan and juneau alaska usa alaska ketchikan holland america zaandam ship cruises through sparkling waters towards an orange sunset between ketchikan and juneau alaska with the inside passage usa alaska ketchikan holland america zaandam shore tours or land tours holland america zaandam shore tours or land tours bicycling honey bee on a colorful common thistle by the wild wolf river within the wolf river refuge and northeastern wisconsin usa wi white lake honey bee on a common thistle by the wild wolf river within the wolf river refuge and northeast wisconsin usa wi white lake honey bee on a common thistle by the wild wolf river within the wolf river refuge and northeastern wisconsin usa wi white lake honey bee on a common thistle by the wild wolf river within the wolf river refuge usa wi white lake honey bee on flower by the wild wolf river within the wolf river refuge usa wi white lake langlade honey bees on a common thistle by the wild wolf river within the wolf river refuge usa wi white lake honeybee or honeybees or genus apis honeybee or honeybees or genus apis on a thistle of family asteraceae or tribe cynareae or tribe cardueae with the northern boreal forest of northeastern wisconsin usa horseback riders on the lake louise lakeshore trail within unesco world heritage site banff national park horseshoe bay hot air balloonists view of golden farmlands and forests as balloon begins its descent south of rock lake and lake mills hsiueapap_7719_ato.westusacanada2014can.ab.banff.banffnp.fairmontbanffspringshotel.banffshireclubb hsiupap_8759_ak07sewardaktoanchoragedenaliparkak.mountainsframesewardboatharboratholidayinnexpressb or sharegroup canoekayakwhitewaterracingo at httpwww.robertarthurobstphotos.comshareucsda727pe6fg or sharegroup celebrationso at httpwww.robertarthurobstphotos.comsharepjckbeb4lifcl httprobertarthurobstphotos.comor sharegroup canoekayakwhite httprobertarthurobstphotos.comor sharegroup canoekayakwhitewaterracingo at httpwww.robertarthurobstphotos.comshareucsda727pe6fg httpswww.facebook.comobstphotos human family watching a goat family kids and parents watching mountain goat parents and kid grazing in the snowy terrain near hidden lake by the hidden lake nature trail southwest of goingtothesun road and logan pass within glacier national park humanscapes inpirational unforgettable events and people and places humanscapes inspirational humanscapes inspirational architectural design and layout humanscapes inspirational celebrating freedom and its defenders humanscapes inspirational celebrating freedom and its defenders god bless america humanscapes inspirational historic ancient constructions humanscapes inspirational memorable events and people humanscapes inspirational memorials and monuments and historic places humanscapes inspirational memorials and monuments and historic places or sites humanscapes inspirational unforgettable events and people humanscapes inspirational unforgettable events and people and places humerous or funny cat hummingbird clearwing moth or hemaris thysbe of the sphingidae family in a flower garden by the wild wolf river within the wolf river refuge usa wi white lake humpback whale tail humpback whales humpback whales bubble net feeding surprisingly close to our boat within the lynn canal near auke bay of the pacific ocean usa alaska juneau humpback whales bubble net fishing ice ice age national scenic trail in wisconsin usa ice age national scenic trail within devils lake state park ice cave and ice formations images by bob obst ice fields parkway in jasper national park alberta canada iceland geysir hot springs iceland gullfoss iceland landeyjasandur heimaey island area iceland landmannalaugar hekla volcano area iceland pingvellir iceland reykjavik icf or international canoe federation sponsored event icf or international canoe federation world championships in slalom canoe kayak whitewater if obst fav photos nikon d800 sports fun extraordinaire image 7804 one can buy it with professional printing or share it and others like it here if one likes adventure travel images like these one can buy the if one likes adventure travel images like these one can buy them with professional printing or share it and others like it here if one likes adventure travel obst images like these one can bu if one likes adventure travel obst images like these one can buy them with professional printing or share it and others like it here if one likes obst fav photos 2013 nikon d300s daily best or fav obst image 5947 one can buy it with professional printing or share it and others like it here if one likes obst fav photos 2013 nikon d300s landscapes inspirational image 6435 one can buy it with professional printing or share it and others like it here if one likes obst fav photos 2013 nikon d300s nature enchanting image 6069 one can buy it with professional printing or share it and others like it here if one likes obst fav photos 2013 nikon d300s sports fun extraordinaire image 6061 one can buy it with professional printing or share it and others like it here if one likes obst fav photos 2013 nikon d800 madison middleton area university of wisconsin madison arboretum images one can buy it with professional printing or share it and others like it here if one likes obst fav photos 2014 nikon d300s destinations wild scenic image 6761 one can buy it with professional printing share it and others like it here if one likes obst fav photos 2014 nikon d800 daily best obst image 4823 one can buy it with professional printing or share it and others like it here if one likes obst fav photos 2014 nikon d800 landscapes inspirational image 5096 one can buy it with professional printing share it and others like it here if one likes obst fav photos nikon d300s nature enchanting image 7595 one can buy it with professional printing or share it and others like it here if one likes obst fav photos nikon d300s sports fun extraordinaire image 7572 one can buy it with professional printing or share it and others like it here if one likes obst fav photos nikon d800 adventures in paddlesport competition images like these one can buy them with professional printing or share it and others like it here if one likes obst fav photos nikon d800 collage of daily best obst images 9622891390649478957297189913c one can buy it with professional printing or share it and others like it here if one likes obst fav photos nikon d800 daily best obst image 0078072502370079062607550535053605290550 one can buy it with professional printing or share it and others like it here if one likes obst fav photos nikon d800 destinations wild scenic image 7608 one can buy it with professional printing or share it and others like it here if one likes obst fav photos nikon d800 destinations wild scenic image 8122 one can buy it with professional printing or share it and others like it here if one likes obst fav photos nikon d800 destinations wild scenic image 8130 one can buy it with professional printing or share it and others like it here if one likes obst fav photos nikon d800 destinations wild scenic image 8250 one can buy it with professional printing or share it and others like it here if one likes obst fav photos nikon d800 humanscapes inspirational image 7719 one can buy it with professional printing or share it and others like it here if one likes obst fav photos nikon d800 obst daily best image 0079 if one likes obst fav photos nikon d800 sports fun extraordinaire image 7839 one can buy it with professional printing or share it and others like it here if one likes obst photos 2010 nikon d300s obst family adventure travel program image collage 797435307986353579913536 one can buy it with professional printing or share it and others like it here if one likes obst photos 2015 nikon d800 madison middleton area outings images one can buy it with professional printing or share it and others like it here if one likes obst photos 2015 nikon d810 adventure travel obst iceland images one can buy it with professional printing or share it and others like it here if one likes obst photos 2015 nikon d810 or nikon d800 obst family celebrations images like these one can buy them with professional printing or share it and others like it here if one likes obst photos 2016 nikon d800 or nikon d810 wolf riv if one likes obst photos 2016 nikon d800 or nikon d810 wolf river refuge obst celebrations fourth of july images like this one can buy it with professional printing share it and others like it here if one likes obst photos 2016 nikon d810 or nikon d800 obst adv if one likes obst photos 2016 nikon d810 or nikon d800 obst adventures in paddlesport competition whitewater open canoe images like these if one likes obst photos nikon d300s wolf river refuge images like these one can buy them with professional printing or share it and others like it here if one likes obst photos nikon d800 adventure travel retirement if one likes obst photos nikon d800 adventure travel retirement program images like this one can buy them with professional printing or share it and others like it here if one likes obst photos nikon d800 adventures in paddlesport competition image 0037 if one likes obst photos nikon d800 adventures in paddlesport competition image 0038 if one likes obst photos nikon d800 adventures in paddlesport competition image 0185 if one likes obst photos nikon d800 adventures in paddlesport competition images like these one can buy them with professional printing or share it and others like it here if one likes obst photos nikon d800 adventures in paddlesport w if one likes obst photos nikon d800 adventures in paddlesport whitewater competition images like these one can buy them with professional printing or share it and others like it here if one likes obst photos nikon d800 adventures travel images like these one can buy them with professional printing or share it and others like it here if one likes obst photos nikon d800 and nikon d300 adventures in paddlesport competition wolfmantriathlon images like these one can buy them with professional printing or share it and others like it here if one likes obst photos nikon d800 madison middleton area outi if one likes obst photos nikon d800 madison middleton area outings images like these one can buy them with professional printing or share it and others like it here if one likes obst photos nikon d800 or d300 adventures in paddlesport competition and river friend images like these one can buy them with professional printing or share it and others like it here if one likes obst photos nikon d800 spring into yellowstone images like this one can buy them with professional printing or share it and others like it here if one likes obst photos nikon d800 wolf river refuge images li if one likes obst photos nikon d800 wolf river refuge images like these one can buy them with professional printing or share it and others like it here if one likes obst photos nikon d810 wolf river refuge images like these one can buy them with professional printing or share it and others like it here if one likes oobst fav photos 2014 nikon d800 destinations wild scenic image 4374 one can buy it with professional printing share it and others like it here image capture date 03 july 2014 in glacier national park image captured by bob obst on 09 september 2014 image captured by bob obst on 29 august 2014 image captured while hiking the cascade canyon trail within grand teton national park wyoming usa image captured while hiking the jenny lake trail within grand teton national park wyoming usa image collage of double mens canoe teams or c2's and single kayak men or k1's 'going for it' during their qualification and semifinal races on the 19 september 2014 at the 2014 icf 'deep creek' world championships at the adventure sports center international site near deep creek lake image collage of kayakers and canoeists blasting through foam concentration and chaos for kayak and canoe competitors during the 2014 wolfman triathlon in sherry rapids at 912 cubic feet per second or 8.91 ft on the langlade usgs gauge on section 2 of the wild wolf river image collage of paddlers' and boaters' views of bald eagles within alaskan waters of the pacific ocean between juneau and homer alaska usa usa ak juneau image collage of paddlers' and boaters' views of humpback whales and bald eagles within alaskan waters of the pacific ocean between juneau and homer alaska usa usa ak juneau image collage of paddlers' and boaters' views of killer whales aka orcas or orcinus orca near juneau cruising the sounds and inside passages within the gulf of alaska of the pacific ocean between ketchikan and slagway alaska usa ak juneau image collage of paddlers' and boaters' views of spectacular areas that are teeming with whales and wildlife such as seals and shore birds crusing the sounds and inland passages within the gulf of alaska of the pacific ocean between ketchikan and homer alaska usa ak seward image collage of taylor hunt and colin hunt in a k2 2014 november 1 green river narrows extreme whitewater race usa nc saluda image date 08 may 2014 image image from laurance s. rockefeller preserve lake creek to woodland trail loop 3.1 miles round trip requiring 1.5 hours with 350 ft total climbing along lake creek to the shore of phelps lake and return to laurance s. rockefeller preserve via the woodland trail image of mule deer captured outside my tent in my signal mountain campsite within grand teton national park wyoming usa image scanned and digitized from an orignal slide taken by bob obst on 27 august 1987 images by imagery creation evangelist bob obst images by imagery creation evangelist bob obst of his fav or fav images by imagery creation evangelist bob obst of his fav or favorite obst family outings within sixty miles or 60 mi or about an hour drive from the madison and middleton areas of southern wisconsin images by imagery creation evangelist bob obst of his fav or favorite obst family outings within sixty miles or 60 mi or about an hour drive from the wolf river refuge area of northeastern wisconsin images by imagery creation evangelist robert arthur obst or bob obst images by imagery creation evangelist robert arthur obst images captured by bob obst images captured by bob obst between 850 am and 11 am on 6 september 2014 images captured by bob obst on 31 august 2014 images captured by robert arthur obst images from the best of environment and nature andor fav or fa images from the best of environment and nature andor fav or favorite obst family outings within sixty miles or 60 mi or about an hour drive of the wolf river refuge near langlade and white lake within northeastern wisconsin usa images of adventure travel with kids within iceland by © robert arthur obst andor the estate of robert a. obst images of paddlers' and boaters' views of spectacular areas within alaska's inside passage that are teeming with whales and wildlife such as seals and shore birds images of the university of wisconsin madison arboretum by © robert arthur obst andor the estate of robert a. obst images of the wolfman triathlon on or near the wild wolf river within langlade county near langlade and white lake wisconsin usa by copyright © robert a. obst impressive eruption of the strokkur geysir or 'the churn' within the colorful geysir hot springs area of south western iceland major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 4 august 2015 indian lake county park indian lake park of dane county images from fav or favorite obst family outings within sixty miles or 60 mi or about an hour drive of the madison and middleton areas within southern wisconsin usa inflatable kayak with wideeyed kayaker plunging over sullivan falls on section 4 of the wild wolf river between otter slide and big smoky falls within the menominee indian nation of wisconsin usa wi keshena inside passage or inland passage coastal route through islands on pacific coast of north america from southeastern alaska in the united states through western british columbia in canada to northwestern washington state in the united states inspirational iris is a greek word for rainbow irises are perennial herbs which grow from creeping rhizomes called rhizomatous irises or in drier climates from bulbs called bulbous irises jasper national park of canada within alberta and british columbia jenny lake trail hiker's view of a storm screaming from south to north up jenny lake within grand teton national park jenny lake trail hiker's view of hidden falls on cascade creek within grand teton national park john hopkins inlet john hopkins inlet of glacier bay of cross sound of the pacific ocean johnston canyon of banff national park and alberta canada four star plus images by obst creatiive imagery bob obst johnston creek to bow river to saskatchewan river to lake winnipeg to nelson river to hudson bay joys of sea kayaking july fourth 4 holiday celebrations parade juneau alaska usa juneau icefield k1 kayak single men bib number 11 neveu boris of france final rank 1 out of 74 and 2014 world champion racing at the 2014 'deep creek' icf or international canoe federation slalomwhitewater world championships within the adventure sports center international or asci site near deep creek lake and mchenry md usa usa md mchenry k1 kayak single men bib number 5 lefevre fabien of the usa final rank 10 out of 74 racing at the 2014 'deep creek' icf or international canoe federation slalomwhitewater world championships within the adventure sports center international or asci site near deep creek lake and mchenry md usa usa md mchenry k1 kayak single men slalomwhitewater final 20 sept 2014 start time 1302 at the 2014 'deep creek' icf or international canoe federation world championships within the adventure sports center international or asci site near deep creek lake and mchenry md usa k1 kayak single men slalomwhitewater final 20 sept 2014 start time 1302 at the 2014 'deep creek' icf or international canoe federation world championships within the adventure sports center international or asci site near deep creek lake and mchenry md usa usa md mchenry kachemak bay kachemak bay state park kaiser klam brandenburger ache river kramsach austria kaiser klamm brandenburger ache river kramsach austria kantishna experience bus ride within denali national park usa ak denali park kantishni experience bus ride within denali national park usa ak denali park kayak men junior daniel watkins of australia negotiating gate 9 during the finals of the 2012 icf canoe slalom junior and u23 world championships usa wi wausau kayak men junior daniel watkins of australia positioning for gate 10 during the finals of the 2012 icf canoe slalom junior and u23 world championships usa wi wausau kayak single women or k1w individual bronze medalist pfeifer melanie of germany final rank 3rd out of 52 k1w competitors during her final run on 21 sept 2014 at the 2014 icf 'deep creek 'world championships at the adventure sports center international site near deep creek lake and mchenry md usa kayak single women or k1w individual gold medalist and world champion fox jessica final rank 1st out of 52 competitors during her final run on 21 sept 2014 at the 2014 icf 'deep creek 'world championships at the adventure sports center international site near deep creek lake and mchenry md usa kayak single women or k1w individual gold medalist and world champion fox jessica of australia final rank 1st out of 52 competitors during her final run on 21 sept 2014 at the 2014 icf 'deep creek 'world championships at the adventure sports center international site near deep creek lake and mchenry md usa usa md mchenry kayak single women or k1w individual silver medalist pennie fiona of great britain final rank 2nd out of 52 k1w competitors during her final run on 21 sept 2014 at the 2014 icf 'deep creek 'world championships at the adventure sports center international site near deep creek lake and mchenry md usa kayak single women or k1w individual silver medalist pennie fiona of great britain final rank 2nd out of 52 k1w competitors during her final run on 21 sept 2014 at the 2014 icf 'deep creek 'world championships at the adventure sports center international site near deep creek lake and mchenry md usa usa md mchenry kayak single women or k1w team france final runs final rank 1st out of 13 k1w teams on 21 sept 2014 at the 2014 icf 'deep creek 'world championships at the adventure sports center international site near deep creek lake and mchenry md usa kayak single women or k1w team usa mann dana and nee ashley and ifarraguerri anna maria final runs final rank 10th out of 13 k1w teams on 21 sept 2014 at the 2014 icf 'deep creek 'world championships at the adventure sports center international site near deep creek lake and mchenry md usa kayaker exploding through a large wave in crystal rapids at mile ninetyeight 98 of the colorado river within grand canyon national park usa az grand canyon kayakers kayakers within the kaiser klamm of the brandenburger ache river below the kaiserhaus erzherzog johann klaus trail austria tyrol kramsach kenai fjords national park kenai fjords tours kenai mountains alaska usa kenai peninsula kennicott glacier flows southeast past snowy mountains towards kennicott and mccarthy within wrangell st. elias national park and preserve usa alaska mccarthy keweenaw peninsula lake shore drive hobard state park view of a lake superior sunset keweenaw peninsula lake shore drive town park view of a lake superior copper harbor sunset keweenaw peninsula lake shore drive town park view of a lake superior sunset keweenaw peninsula of the upper peninsula of michigan lake shore drive town park kicking horse river below natural bridge tumbling west towards mt. deville near field within yoho national park can bc field kicking horse river to columbia river to pacific ocean kicking horse river valley canada british columbia field kids youth tandem canoe killer whale or orca or orcinus orca killer whale or orcinus orca or orca or blackfish kingdom animalia and phylum arthropoda and class insecta and order hymenoptera and suborder apocrita or wasps kingdom animalia and phylum arthropoda and class insecta and order lepidoptera and family nymphalidae and genus heliconius and species h. charithonia or zebra butterfly kingdom animalia and phylum arthropoda and class insecta and order lepidoptera and family nymphalidae and tribe heliconiini and genus dryas and species d. iulia or dryas iulia kingdom animalia and phylum arthropoda and class insecta and order lepidoptera and family papilionidae and genus papilio and species p. troilus or spicebush swallowtail or papilio troilus kingdom animalia and phylum arthropoda and class insecta and order lepidoptera and heterocera or moth kingdom animalia and phylum arthropoda and subphylum chelicerata and arachnomorpha and class arachnida and order araneae kingdom animalia and phylum chordata and class aves and order accipitriformes or falconiformes and family pandionidae and genus pandion and species p. haliaetus and binomial name pandion haliaetus or osprey kingdom animalia and phylum chordata and class aves and order anseriformes and family anatidae and subfamily anserinae and tribe anserini and genus chen and species c. caerulescens or chen caerulescens kingdom animalia and phylum chordata and class mammalia and order artiodactyla and family bovidae and subfamily caprinae and genus ovis and species ovis dalli kingdom animalia and phylum chordata and class mammalia and order artiodactyla and family cervidae and genus odocoileus and species o. hemionus and binomial name odocoileus hemionus or mule deer kingdom animalia and phylum chordata and class mammalia and order artiodactyla and family cervidae and subfamily capreolinae and genus rangifer and species rangifer tarandu or reindeer or caribou kingdom animalia and phylum chordata and class mammalia and order carnivora and family canidae and tribe vulpini and genus vulpes and species vulpes vulpes or red fox kingdom animalia and phylum chordata and class mammalia and order carnivora and family ursidae and genus ursus and species u. americanus or american black bear or ursus americanus kingdom animalia and phylum chordata and class mammalia and order rodentia and suborder hystricomorpha and infraorder hystricognathi and common name north american porcupine kingdom animalia and phylum chordata and subphylum vertebrata and class aves and order gruiformes and family gruidae and genus grus and species g. canadensis or sandhill crane or grus canadensis kingdom animalia phylum chordata class aves order galliformes family phasianidae subfamily meleagridinae genus meleagris species meleagris gallopavo or wild turkey kingdom animalia phylum chordata class mammalia order artiodactyla family cervidae subfamily capreolinae genus alces species a. alces binomial name alces alces or moose kingdom animalia phylum chordata class mammalia order carnivora family felida genus felis species f. catus or felis catus or felis silvestris catus humanscapes inspirational unforgettable events and people and places kingdom animalia phylum chordata class mammalia order carnivora family felidae genus felis species f. catus or binomial name felis catus kingdom plantae and angiosperms and eudicots and asterids and order cornales and family hydrangeaceae and genus hydrangea and species h. paniculata or hydrangea paniculata kingdom plantae and angiosperms and eudicots and asterids and order lamiales family lamiaceae and genus agastache or agastache scrophularlaefolia or giant hyssop kingdom plantae and angiosperms and eudicots and order ranunculales and family ranunculaceae and subfamily ranunculoideae and tribe anemoneae and genus clematis kingdom plantae and angiosperms and eudicots and rosids and order fagales and family fagaceae and genus quercus or quercus lepidobalanus or quercus leucobalanus kingdom plantae and division magnoliophyta and eudicots and order myrtales and family onagraceae and genus epilobium and species e. angustifolium or common name fireweed kingdom plantae and division magnoliophyta monocots and order asparagales and family iridaceae and subfamily iridoideae and tribe irideae and genus iris kingdom plantae angiosperms eudicots rosids order rosales family rosaceae subfamily amygdaloideae tribe maleae subtribe malinae genus malus or apples klondike gold rush international historical park klondike highway known as yosemite of the north is misty fiords national monument of usa alaska ketchikan l11 l11b lake lake mendota lake mendota to yahara river to lake monona to yahara river to rock river to mississippi river to the gulf of mexico and altantic ocean lake mendota to yahara river to rock river to mississippi river to gulf of mexico and the atlantic ocean lake superior lake superior circle tour lake superior circle tour adventure travel lake superior circle tours lake superior circle trail lake superior hiking trail lake superior ice caves and ice formations extraordinaire lake superior provencial park lake superior provincial park lake superior to st. marys river to lake huron to st. clair river to lake st. clair to the detroit river to lake erie to niagara river to lake ontario to st. lawrence river to the atlantic ocean lakemills landscape landscape inspirational autumn beauty landscape inspirational glaciers and icefields landscape inspirational waterfall landscapes landscapes autumn beauty landscapes canyons landscapes inspirational landscapes inspirational at httpwww.robertarthurobstphotos.comlandscapesinspirational landscapes inspirational at httpwww.robertarthurobstphotos.comlandscapesinspirational or landscapes inspirational canyons and gorges at httpwww.robertarthurobstphotos.comlandscapesinspirationallicanyonsgorges landscapes inspirational autumn beauty landscapes inspirational autumn beauty or autumn magic landscapes inspirational badlands after rain landscapes inspirational canyon landscapes inspirational canyons landscapes inspirational canyons and gorges landscapes inspirational canyons and gorges at httpwww.robertarthurobstphotos.comlandscapesinspirationallicanyonsgorges landscapes inspirational early morning or late evening light landscapes inspirational geothermal volcanic landscapes inspirational glaciers and icefields landscapes inspirational ice caves and ice formations landscapes inspirational iceland landscapes inspirational moon rise and moon glow landscapes inspirational moon rise moon set landscapes inspirational moon rise or moon set and moon glow landscapes inspirational moonrise landscapes inspirational moonrise and moonset landscapes inspirational mountains landscapes inspirational mountains canadian rockies landscapes inspirational mountains canadian rockies waputik mountains mount sarbach landscapes inspirational mountains images by robert a. obst landscapes inspirational rainbows landscapes inspirational reflections landscapes inspirational reflections images by robert a. obst landscapes inspirational rivers landscapes inspirational sea and lake shores landscapes inspirational sea and lake shores images by robert a. obst landscapes inspirational sea lake shores landscapes inspirational sunrise landscapes inspirational sunrise sunset landscapes inspirational sunrises landscapes inspirational sunrises and sunsets landscapes inspirational sunrises sunsets landscapes inspirational sunset landscapes inspirational sunsets landscapes inspirational sunsets and sunrises landscapes inspirational sunsets sunrises landscapes inspirational university of wisconsin madison arboretum landscapes inspirational waterfall landscapes inspirational waterfalls landscapes inspirational winter beauty landscapes inspirational winter beauty and solitude landscapes inspirational winter wonderlands and snowfall magic landscapes mountains landscapes mountains destinations wild national parks adventures travel western usa montana mt glacier national park gnp landscapes sunsets landscapes sunsets sunrises landscapesinspirational latitude 43.077008 latitude 43.177849 latitude 46.708359 latitude 46.708593 latitude 47.327788 latitude 47.47886 latitude 47.47886 longitude 87.951032 latitude 48.588224 latitude 48.588224 longitude 86.293859 latitude is 47.47886 and longitude is minus 87.951032 laurance s. rockefeller preserve is a 1106 acre or 448 ha refuge on the southern end of phelps lake within grand teton national park legendary old military road liab_4799_ob2010.usa.wi.mmo.baraboo.dlsp.wbt.vne.autumnmagicembracesdevilslakeb liab_4892_ob2010.wrrfo.usa.wi.whitelake.wolfriver.s2.sherryrapids.autumnembracesthewolfriverb liab_6432_lsct.usa.lutsen.brilliantautumnwoodsblueskiesembracesteepshoresofcascaderiverwithincrspb linville gorge wilderness area linville state natural river linvillegorge linvilleriver liquid ice flowing down the wild wolf river section 2 by the wolf river refuge rocklighthouseoverlookingfrozenlakesuperiorb lisas_2827_wrr.besten.usa.wi.whitelake.sunsetoverwolfriverrefugefromwolfriverrefugeaccessroadb lizards of the kingdom animalia phylum chordata superclass tetrapoda class reptilia order squamata suborder lacertilia or superorder lepidosauria order squamata local chapter of veterans of foreign wars vfw marching proudly during the annual fourth of july holiday parade in white lake usa wi white lake lochsa river logan pass longenecker gardens of the university of wisconsin madison arboretum usa wi madison longenecker horticultural gardens feature displays of lilacs and flowering crabapples and viburnums and conifers and many other plant groups longitude 84.61431 longitude 86.293859 longitude 87.951032 longitude 89.400034 longitude 89.471898 longitude 89.972219 longitude 89.97867 looking southwest towards the columbia icefield and mount columbia looking towards the columbia icefield and mount andromeda and mount athabasca up the sunwapta river valley low afternoon sun over thetreinen farm corn maze and watch towe low afternoon sun over thetreinen farm corn maze and watch tower fav or favorite obst family outings within sixty miles or 60 mi or about an hour drive from the cities of madison and middleton of southern wisconsin usa usa wi madison middleton area lodi lower wisconsin state riverway at ferry bluff lowersflowersandmoreflowers lspp lunch lunch break for hungry paddlers within granite gorge between trinity and salt creeks at mile ninetytwo 92 of the colorado river within grand canyon national park usa az grand canyon lush green gail river valley of austria borders austria and italy europe austria obertilliach gail river valley lushgreenvalley lushgreenvalleyserpentinefastriver lutschine river switzerland lutschine to aare to rheine rivers watershed of switzerland lynn canal lynn canal auke bay pacific ocean lynn canal of the pacific ocean macro madison and middleton area family outings governor nelson state park madison and middleton area governor nelson state park madison and middleton area outing bishops bay madison and middleton area outing governor nelson state park madison and middleton area university of wisconsin madison arboretum madison area family best outings madison area family outings madison area family outings bishops bay madison area family outings governor nelson state park madison area family outings olbrich botanical gardens madison area family outings university of wisconsin madison arboretum madison family favorite outings madison family favorite outings olbrich botanical gardens madison family outings madison middleton area family favorite outings madison middleton area favorite obst family outings madison middleton area obst family favorite outings madison middleton area obst family outings madison middleton area outings madison middleton area outings ballooning madison middleton area outings devil's lake state park usa wisconsin baraboo madison middleton area outings indian lake county park usa wi cross plains madison middleton area outings near madison and middleton wi usa governor nelson state park madison middleton area outings near the madison and middleton ar madison middleton area outings near the madison and middleton areas of wisconsin usa madison middleton area outings neenah creek madison middleton area outings rhythm and booms madison middleton favorite family outings university of wi madison memorial union terrace madison middleton favorite family outings university of wisconsin madison memorial union terrace madison middleton obst family jennifer residence madison middleton outings madison middleton outings dlsp madison outings university of wisconsin madison madison outings university of wisconsin madison campus mage collage of paddlers' and boaters' views of american or bald eagles or haliaeetus leucocephalus within alaskan waters of the pacific ocean between juneau and homer alaska usa usa ak juneau homer magic walkways wind through gorgeous flower gardens under crystal blue skies within allen centennial gardens of the university of wisconsin madison major adventure travel obst retirement program to usa wy spring major adventure travel obst retirement program to usa wy spring into yellowstone images by © robert arthur obst andor the estate of robert a. obst major adventure travel robert obst retirement program or adventure travel obst family on ice or obst adventures with kids within and around and across iceland 2015 major adventure travel robert obst retirement program phase 1 major adventure travel robert obst retirement program phase 1 2013 september 7 to 22 usa sd and wyand ia badlands national park or np and mount rushmore national monument and yellowstone np and grand teton np major adventure travel robert obst retirement program phase 1 2013 september 7 to 22 usa sd and wyand ia badlands national park or np and mount rushmore national monument and yellowstone np and grand teton np and drake university in iowa major adventure travel robert obst retirement program phase 12013 september 7 to 22 usa sd and wyand ia badlands national park or np and mount rushmore national monument and yellowstone np and grand teton np major adventure travel robert obst retirement program phase 3 major adventure travel robert obst retirement program phase 3 porcupine mountains wilderness state park major adventure travel robert obst retirement program phase 4 major retirement adventure travel by robert arhtur obst tofrom major retirement adventure travel by robert arhtur obst tofrom usa wy cody 13 to 17 may 2015 spring into yellowstone events major retirement adventure travel by robert arhtur obst tofrom usa wy cody 13 to 17 may 2015 spring into yellowstone events including selfguided tours of yellowstone national park and grand teton national park and return to usa wi middleton major retirement adventure travel by robert arhtur obst tofrom usa wy cody 13 to 17 may 2015 spring into yellowstone events including selfguided tours of yellowstone national park and grand teton national park including a visit to harry robert house and jan hansen within alpine wyoming and return to usa wi middleton maligne lake to maligne river to athabasca river to slave river to great slave lake to mackenzie river to arctic ocean maligne river to athabasca river to slave river to great slave lake to mackenzie river to arctic ocean maligne river valley mountain goats within jasper national park malus or apples are deciduous trees or shrubs in the family rosaceae manabezho falls crowned by autumn color manabezho falls north of south boundary road during autumn manabezho falls of presque isle river north of south boundary road during autumn manido falls of presque isle river north of south boundary road during autumn margerie glacier on tarr inlet on glacier bay within glacier bay national park and preserve margerie glacier on tarr inlet on glacier bay within glacier national park and preserve marpole and the president mountains of the canadian rockies tower over a boat on emerald lake within unesco world heritage site yoho national park near field marpole and the president mountains of the canadian rockies tower over a canoe on emerald lake within unesco world heritage site yoho national park near field marpole and the president mountains of the canadian rockies tower over canoes on emerald lake within unesco world heritage site yoho national park near field matawaska river area meeting friendly caribou along alaskan trails melting icicles adorn sandstone cave roofs within apostle islands national lakeshore on lake superior memorial union terrace memories of arthur robert obst memories of arthur robert obst captured by robert a. obst mendenhall glacier mi8 michigan best photos michigan photos michigan photos during winter michigan wild areas during winter photos michigan wild areas photos middleton middleton obst family outings military mistaya river to north saskatchewan river to saskatchewan river to lake winnipeg misty fiords national monument or misty fjords national monument mmao mmaognsp_nnnn_usa.wi.waunakee.jr.outings.governornelsonsp.hikingu mmaoutings_images_usa.wi.baraboo.devilslakestateparku mmaoutings_images_usa.wi.crossplains.indianlakeparkdanecountyu mmaoutings_images_usa.wi.saukcity.ferrrybluffstatenaturalareau mmoutingso mmoutingso outings near the madison and middleton areas of south mmoutingso outings near the madison and middleton areas of southern wisconsin usa mmoutingso sharegroup mmoutingso sharegroup by bob obst montana best photos montana mt montana photos moon over sailboat and capitol after rythme and booms moon phase waxing gibbous visible 90 age 12 days over indian lake county park usa wi cross plains moonlight magic over sherry rapids on the wild wolf river usa wi white lake morning light and fog over the inside passage of the pacific ocean between vancouver and ketchikan moth on giant hyssop plant within longenecker gardens of the university of wisconsin madison arboretum usa wi madison moth or heterocera on a agastache scrophularlaefolia or giant hyssop plant within longenecker gardens of the university of wisconsin madison arboretum usa wi madison mount alyeska mount alyeska of the chugach mountain range within alaska mount andromeda and mount athabasca cradle the columbia icefield near sunwapta pass within jasper national park canada alberta jasper mount drum mount gould near logan pass within glacier national park mount mckinley or denali mount mckinley or denali or koyukon athabaskan for the high one or dghelaaycee in ahtna mount turner and mount forde alaska usa mount wrangell mountain goat mountain goat or rocky mountain goat scientific classification kingdom animalia and phylum chordata class mammalia and order artiodactyla and family bovidae and subfamily caprinae and genus oreamnos and species oreamnos americanus mountain goat surveying the heart of his glacier national park domaine from the hidden lake nature trail southwest of goingtothesun road and logan pass mountains mountains encircle rock isle lake near the rock isle trailgarden parth trail junction of the sunshine meadows trail system near the continental divide of the canadian rockies and the albertabritish columbia border within banff national park and alberta canada 2014 obst family adventure travel program images of exploring the national parks of the canadian rockies within alberta and british columbia canada can alberta banffsunshine meadows mountains towering over jenny lake along the jenny lake trail within grand teton national park mountains view mt mt. olympus village outdoor theme park roller coaster zeus mt. saskatchewan and cirrus mountain within banff national park mule deer grazing near the maligne river canyon within jasper national park mule deer within the bridgerteton national forest and the valley of the upper greys river watershed near alpine wyoming major retirement adventure travel by robert arhtur obst tofrom usa wy 13 to 27 of may 2015 spring into yellowstone events including selfguided tours of yellowstone national park and grand teton national park areas and return to usa wi middleton usa wy alpine mule deer within the valley of the upper greys river near alpine mule deer within the valley of the upper greys river near alpine wyoming major retirement adventure travel by robert arhtur obst tofrom usa wy 13 to 27 of may 2015 spring into yellowstone events including selfguided tours of yellowstone national park and grand teton national park areas and return to usa wi middleton usa wy alpine muskox or ovibos moschatus or musk ox or an arctic mammal of the bovidae family national national wild and scenic river nature nature animals nature animals eagles nature enchanting nature enchanting animals nature enchanting animals wild nature enchanting animals wild birds nature enchanting best of the birds nature enchanting birds nature enchanting butterflies and insects nature enchanting flowers nature enchanting flowers and foliage nature enchanting flowers and forests and foliage nature enchanting flowers flowers flowers nature enchanting flowers forest foliage nature enchanting flowers forests and foliage nature enchanting flowers forests foliage nature enchanting galleries by bob obst nature enchanting insects and butterflies nature enchanting macros and micros nature enchanting other than birds nature enchanting weather extraordinaire nature enchanting wildlife nature enchanting wildlife animals wild nature enchanting wolf river refuge favorites nature photograhers nature photographers nature photographers iceland naturephotographers near neaw_6069_usa.wy.moose.grandtetonnp.laurancesrockefellerpreserve.phelpslakehikersview.porcupineb nebirds_7595_wrroutingsck.usa.wi.langlade.wolfriver.s3.between20dayandboyscoutrapids.ospreyb nebirds_8720_8732_ak07sewardaktoanchoragedenaliparkak.sealifecenterofseward.puffinsb neenah creek nef nefff.lim_3057_ato2010can.bc.rhs.kootenaynpflowers.marblecanyonb nicolet national forest nikon nizina glacier nordic skier's and hiker's view of blue skies and icicles framing a yawning sandstone cave mouth within apostle islands national lakeshore on lake superior nordic skier's and hiker's view of blue skies over ice and snow covered sandstone cliffs within apostle islands national lakeshore on lake superior nordic skier's and snowshoer's view of ice and deep snow over the boiling cascade river during winter within cascade river state park nordic skier's and snowshoer's winter beautfy view of snow and ice framing a boiling in temperance river canyon pool within temperance river state park nordic skier's gorgeous view of blue skies framing deep powder snow drifts over a frozen sherry rapids on section 2 of the wolf river near the wolf river refuge nordic skier's gorgeous view of blue skies framing deep powder snow drifts over section 2 of the wild wolf river between cedar and sherry rapids near the wolf river refuge nordic skier's gorgeous view of blue skies framing deep snow drifts over a frozen sherry rapids on section 2 of the wolf river near the wolf river refuge nordic skier's view of a moonrise over indian lake county park nordic skier's view of gorgeous deep powder snow blanketing the rugged valley and waterfalls of the amnicon river within amnicon falls state park nordic skier's view of gorgeous deep powder snow blanketing the rugged valley of the amnicon river within amnicon falls state park nordic skier's view of icicles hanging from ice cave roof within apostle islands national lakeshore on lake superior during winter nordic skier's winter beauty view of indian lake and bordering woodlands under sunny blue skies from the ice age national scenic trail within indian lake park nordic skiers' and hikers' view from inside an ice cave of lake superior within apostle islands national lakeshore nordic skiers' and hikers' view of a massive ice pillar embracing undercut sandstone cliffs within apostle islands national lakeshore on lake superior during winter nordic skiers' and hikers' view of blue skies over the ice and snow encrusted sandstone cliffs of apostle islands national lakeshore on lake superior during winter nordic skiers' and hikers' view of blue skies over the icicles adorned sandstone cliffs of apostle islands national lakeshore on lake superior during winter nordic skiers' and hikers' view of cotton candy and blue skies over frosted and root beer tinted icicles that embellish the towering sandstone cliffs within apostle islands national lakeshore on lake superior nordic skiers' and hikers' view of icicle and snow encrusted sandstone cliffs and grottos within apostle islands national lakeshore on lake superior nordic skiing north atlantic ocean europe iceland north carolina natural and scenic rivers system north country national scenic trail northcanyon note the 'capture date of all images within my 'obst family on ice 2015' collection is off by one day before the actual date npam oaks silhouetted by crimson sunrise over lake mendota on bishops bay usa wi middleton ob2010.lis.apw_4733_usa.wi.tomahawk.autumnsunsetoverwiriverb obertilliach obst obst 2011 obst 2011 adventures phase 12 homer alaska to girdwood alaska obst adventures in paddlesport whitewater images obst adventures phase five glacier bay to college fjord obst adventures phase six college fjord to seward alaska usa obst best obst best 1978 obst best 1989 obst best 1991 obst best 1992 obst best 2002 obst best 2006 obst best 2007 obst best 2007 drop shadow obst best 2008 obst best 2008 top fifty obst best 2009 obst best 2010 obst best 2010 sunset obst best 2011 obst best canoe obst best grand canyon photos obst best nature photos obst best or fav photos 2013 obst best photos obst best photos 1984 canoeing obst best photos 1991 rafting whitewater obst best photos 1991 whitewater obst best photos 1993 obst best photos 1993 canoeing obst best photos 2002 obst best photos 2005 obst best photos 2008 obst best photos 2009 obst best photos 2009 canoeing obst best photos 2010 obst best photos 2010 flowers obst best photos 2011 obst best photos 2012 obst best photos 2013 obst best photos autumn obst best photos canyons obst best photos historic obst best photos kayaking obst best photos moonlight obst best photos mountains obst best photos nature animals obst best photos shores obst best photos shores sunsets obst best photos sunset obst best photos waterfalls obst best photos whitewater obst best photos wisconsin obst best sunset photos obst best whitewater photos obst celebrations obst celebrations holidays fourth of july celebrations obst celebrations holidays thanksgiving obst celebrations holidays thanksgiving holiday weekend obst daily best obst daily best or fav image collage obst daily best or favorite photos obst daily best photos obst daily fav images obst daily favorite photos obst family adventure travel west and canada obst family adventure travels 2010 obst family madison and middleton areas outings devil's lake sta obst family madison and middleton areas outings devil's lake state park obst family madison and middleton areas outings indian lake park of dane county obst family madison and middleton areas outings lower wisconsin state riverway ferry blluff state natural area obst family madison middleton area obst family madison middleton area favorite outings obst family madison middleton area favorite outings devils lake state park obst family madison middleton area favorite outings indian lake county park obst family madison middleton area favorite outings lake mendota obst family madison middleton area outings obst family madison middleton favorite outings devils lake state park obst family madison middleton favorite outings dlsp obst family madison middleton outings devils lake state park obst family madison middleton outings dlsp obst family middleton outings bishops bay obst fav 2013 sports fun extraordinaire d300s image 4490b obst fav or daily best photos 2013 obst fav photos obst fav photos 2013 obst fav photos 2013 nikon d800 landscapes inspirational image 7490 obst fav photos 2014 2010 nikon d800 d300s daily best collage images 797435307986353579913536 obst fav photos 2014 nikon d800 adventure travel obst image 7974 obst fav photos 2014 nikon d800 adventure travel obst images obst fav photos 2015 nikon 800 landscapes inspirational moon rise and moon glow image 1410 obst fav photos 2015 nikon d810 sports fun extraordinaire action outdoors image 0183 note the 'capture date of all images within my 'obst family on ice 2015' collection is off by one day before the actual date obst fav photos 2016 nikon 810 adventures in paddlesport competi obst fav photos 2016 nikon 810 adventures in paddlesport competition whitewater open canoe usa nationalsnorth american championships 5 stars image 4997 obst fav photos 2016 nikon d800 adventures in paddlesport compet obst fav photos 2016 nikon d800 adventures in paddlesport competition whitewater open canoe usa nationalsnorth american championships 4 stars image 1562 obst fav photos 2016 nikon d800 adventures in paddlesport competition whitewater open canoe usa nationalsnorth american championships 4 stars image 1638 obst fav photos 2016 nikon d800 adventures in paddlesport competition whitewater open canoe usa nationalsnorth american championships 5 stars image 1562 obst fav photos 2016 nikon d800 landscapes inspirational flowers obst fav photos 2016 nikon d810 adventures in paddlesport compet obst fav photos 2016 nikon d810 adventures in paddlesport competition whitewater open canoe usa nationalsnorth american championships 5 stars image 5530 obst fav photos 2016 nikon d810 adventures in paddlesport competition whitewater open canoe usa nationalsnorth american championships 5 stars image 5657 obst fav photos 2016 nikon d810 adventures in paddlesport competition whitewater open canoe usa nationalsnorth american championships 5 stars image 5682 obst fav photos 2016 nikon d810 adventures in paddlesport competition whitewater open canoe usa nationalsnorth american championships 5 stars image 6039 obst fav photos 2016 nikon d810 adventures in paddlesport competition whitewater open canoe usa nationalsnorth american championships 5 stars image 6094 obst fav photos adventures in paddlesports image collage 607960696070607260766077607860846085 obst fav photos alaskan sailing paddlesports sealife magic exploring the inside or inland passage of the pacific ocean's gulf of alaska beyond usa ak ketchikan juneau skagway seward homer obst fav photos nikon d300s adventure travel alaska image dsc_7804891177007650775689128774m877387928860772888207630collagenikon d300s adventure travel alaska image dsc_7804891177007650775689128774m877387928860772888207630collage obst fav photos nikon d300s nature enchanting image 7595 obst fav photos nikon d300s obst adventure travel alaska image dsc_956095589559 collage obst fav photos nikon d300s obst adventure travel alaska image dsc_9560b7608761476107611collage collage obst fav photos nikon d300s obst adventure travel alaska image dsc_96709670b96739670a779876127732collage obst fav photos nikon d300s sports fun extraordinaire image 7572 obst fav photos nikon d800 adventure travel retirement program images . obst fav photos nikon d800 adventures in paddlesport competition image 0037 obst fav photos nikon d800 adventures in paddlesport competition image 0038 obst fav photos nikon d800 adventures in paddlesport competition images obst fav photos nikon d800 adventures in paddlesport competition slalom images obst fav photos nikon d800 adventures in paddlesport image obst fav photos nikon d800 adventures in paddlesport whitewater competition 5906 through 5915 obst fav photos nikon d800 adventures in paddlesport whitewater competition images 4986 through 5013 obst fav photos nikon d800 adventures in paddlesport whitewater competition images 5014 through 5035 obst fav photos nikon d800 adventures in paddlesport whitewater competition images 5079 through 5086 obst fav photos nikon d800 adventures in paddlesport whitewater competition images 5180 through 5192 obst fav photos nikon d800 adventures in paddlesport whitewater competition images 5237 through 5248 obst fav photos nikon d800 adventures in paddlesport whitewater competition images 5266 through 5278 obst fav photos nikon d800 adventures in paddlesport whitewater competition images 5425 through 5434 obst fav photos nikon d800 adventures in paddlesport whitewater competition images 5565 through 5585 obst fav photos nikon d800 adventures in paddlesport whitewater competition images 5600 through 5610 obst fav photos nikon d800 adventures in paddlesport whitewater competition images 5749 through 5770 obst fav photos nikon d800 adventures in paddlesport whitewater competition images 5873 through 5892 obst fav photos nikon d800 adventures in paddlesport whitewater competition images 6047 through 6059 obst fav photos nikon d800 adventures in paddlesport whitewater competition images 6107 through 6111 obst fav photos nikon d800 adventures in paddlesport whitewater competition images 6160 through 6164 obst fav photos nikon d800 adventures in paddlesport whitewater competition images 6316 through 6319 and 6321 and 6323 through 6337 obst fav photos nikon d800 adventures in paddlesport whitewater competition images 6473 through 6503 obst fav photos nikon d800 collage of daily best obst images 9622891390649478957297189913c obst fav photos nikon d800 daily best obst image 0078072502370079062607550535053605290550 obst fav photos nikon d800 daily best obst image 0894 obst fav photos nikon d800 daily best obst image 5019 obst fav photos nikon d800 daily best obst image 5181 obst fav photos nikon d800 daily best obst image 5243 obst fav photos nikon d800 daily best obst image 5427 obst fav photos nikon d800 daily best obst image 5757 obst fav photos nikon d800 daily best obst image 5906 through 5915 obst fav photos nikon d800 daily best obst image 6109 obst fav photos nikon d800 daily best obst image 6474 obst fav photos nikon d800 daily best obst image 6475 obst fav photos nikon d800 daily best obst image 6502 obst fav photos nikon d800 daily best obst image 7541 obst fav photos nikon d800 destinations wild scenic image 7051 obst fav photos nikon d800 destinations wild scenic image 7531 obst fav photos nikon d800 destinations wild scenic image 8122 obst fav photos nikon d800 destinations wild scenic image 8130 obst fav photos nikon d800 destinations wild scenic image 8250 obst fav photos nikon d800 destinations wild scenic image 8275 obst fav photos nikon d800 obst daily best image 0079 obst fav photos nikon d800 sport fun extraordinaire action outdoors canoe kayak image 5569 obst fav photos nikon d800 sports fun extraordinaire action outdoors canoe kayak image 3038 obst fav photos nikon d800 sports fun extraordinaire action outdoors canoe kayak image 3059 obst fav photos nikon d800 sports fun extraordinaire action outdoors image 5212 obst fav photos nikon d800 sports fun extraordinaire action outdoors image 5365 obst fav photos nikon d800 sports fun extraordinaire action outdoors image 5366 obst fav photos nikon d800 sports fun extraordinaire action outdoors image 5399 obst fav photos nikon d800 sports fun extraordinaire action outdoors image 5878 obst fav photos nikon d800 sports fun extraordinaire canoe kayak image 1764 obst fav photos nikon d800 sports fun extraordinaire canoe kayak image 5229 obst fav photos nikon d800 sports fun extraordinaire canoe kayak image 5642 obst fav photos nikon d800 sports fun extraordinaire image 7605 obst fav photos nikon d800 sports fun extraordinaire image 7804 obst fav photos nikon d800 sports fun extraordinaire image 7808 obst fav photos nikon d810 adventures in paddlesport whitewater obst fav photos nikon d810 adventures in paddlesport whitewater image 4443 obst fav photos nikon d810 daily best 42404263collage obst fav photos nikon d810 daily best image 4443 obst fav photos nikon d810 daily best image 4444 obst fav photos nikon d810 daily best image 4466 obst fav photos nikon d810 daily fav collage image 3342333533413296330333313292 obst fav photos nikon d810 sports fun extraordinaire action outd obst fav photos nikon d810 sports fun extraordinaire action outdoors image 4431 obst fav photos nikon d810 sports fun extraordinaire action outdoos image 4546 obst fav photos nikon d810 wolf river refuge outings canoe and k obst fav photos nikon d810 wolf river refuge outings canoe and kayak image 4252 obst fav photos sports fun extraordinaire action outdoors image obst fav photos sports fun extraordinaire action outdoors image 3303 obst favorite or best photos 2012 obst favorite or best photos 2013 obst favorite or obst best photos obst favorite photos obst favorite photos 2012 obst favorite photos 2013 obst favorite photos wisconsin obst hayes photos best 1987 obst images of great smoky mountains national park obst images of the north carolina arboretum obst photos obst photos 1987 obst photos 20 july 2011 obst photos 2002 obst photos 2007 obst photos 2008 obst photos 2009 obst photos 2010 obst photos 2010 nikon d300s adventure travel obst image collage 797435307986353579913536 obst photos 2011 obst photos 2012 obst photos 2014 nikon d800 adventure travel obst images obst photos 2015 nikon d810 adventure travel obst iceland image 0223 note the 'capture date of all images within my 'obst family on ice 2015' collection is off by one day before the actual date obst photos 2015 nikon d810 adventure travel obst iceland image 0462 note the 'capture date of all images within my 'obst family on ice 2015' collection is off by one day before the actual date obst photos 2015 nikon d810 adventure travel obst iceland image 0867 note the 'capture date of all images captured after 5 am within my 'obst family on ice 2015' collection is off by one day before the actual date obst photos 2015 nikon d810 adventure travel obst iceland image 1002 note the 'capture date of all images captured after 5 am within my 'obst family on ice 2015' collection is off by one day before the actual date obst photos 2015 nikon d810 daily best obst iceland image 1051 note the 'capture date of all images captured after 5 am within my 'obst family on ice 2015' collection is off by one day before the actual date obst photos 2015 nikon d810 or nikon d800 obst family celebrations obst photos 2016 nikon d810 or nikon d800 adventures in paddlesp obst photos 2016 nikon d810 or nikon d800 adventures in paddlesport competition whitewater open canoe obst photos 2016 nikon d810 or nikon d800 adventures in paddlesport competition whitewater open canoe usa nationals images obst photos 2016 nikon d810 white lake centennial 1916 to 2016 celebration fireworks obst photos 2016 nikon d810 white lake centennial celebration 1916 to 2016 fireworks obst photos best obst photos best 1987 obst photos best 2008 obst photos best 2010 obst photos best 2010 obst photos best 2011 obst photos favorite 2012 obst photos favorite 2013 obst photos landscapes waterfalls obst photos madison middleton area outings image 3303 obst photos nature obst photos nature enchanting animals obst photos nikon d300s obst adventure travel alaska image obst photos nikon d300s obst adventure travel alaska image 7617 obst photos nikon d300s obst adventure travel alaska image 7618 obst photos nikon d300s obst adventure travel alaska image 7634 obst photos nikon d300s obst adventure travel alaska image 7635 obst photos nikon d300s obst adventure travel alaska image 7648 obst photos nikon d300s obst adventure travel alaska image 7700 obst photos nikon d300s obst adventure travel alaska image 8628 obst photos nikon d300s obst adventure travel alaska image 8628 or lisals_8628_ato2011.usa.ak06collegefjordaktosewardak.hollandamerica.eeeriefogembracemountainswithincollegefjordb obst photos nikon d300s obst adventure travel alaska image 9560 obst photos nikon d300s obst adventure travel alaska image 9655